Protein Family IF02711
Metagenome
Metatranscriptome
Isolate
210
Members
91
Samples
191
Scaffolds
182.55
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10019186|Ga0123356_100191867
- Length
- 197 aa
- Sequence
- LLYKLIGGKAMSRIGKLPITLPKGVEITRDEKSQIVTVKGAKGELKQYVDGDITFTIEDGKLTLLRPTEQKRHKAMHGLYRALLANMIKGVSEGFEIKQELVGVGYKAEAKPGNQLEMSLGYSHNLIFELCPEVTVETINEKGKNPLIILRGIDKQLMGQVANKIRSYRKPEPYKGKGIRFQGEIVRKKAGKSAEK*
Sample Types
Isolate
9.1%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
1.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.6%
Unclassified
19.5%
Kalotermitidae
14.9%
Formicidae
5.7%
Armadillidiidae
4.6%
Culicidae
4.6%
Rhinotermitidae
3.4%
Termopsidae
2.3%
Passalidae
2.3%
Hydrophilidae
1.1%
Daphniidae
1.1%
Blattidae
1.1%
Elmidae
1.1%
Drosophilidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
191
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 14 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 15 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 18 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 19 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 20 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 32 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 38 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 39 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 40 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 41 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 42 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 43 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 44 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 45 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 52 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 53 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 54 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 61 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 62 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 63 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 64 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 65 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 70 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 71 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 72 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 73 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 74 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 75 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 76 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 77 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 78 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 79 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 80 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 81 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 82 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 83 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 84 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 85 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 86 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 87 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 88 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 89 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 90 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 91 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_120852 | 3300042659 | Bacteria | 8712 |
| 2 | Ga0123355_10023090 | 3300009826 | Bacteria | 9981 |
| 3 | Ga0123356_10102085 | 3300010049 | Bacteria | 2753 |
| 4 | Ga0123356_10221611 | 3300010049 | Bacteria | 1948 |
| 5 | Ga0123356_10594456 | 3300010049 | Bacteria | 1271 |
| 6 | Ga0123356_10830970 | 3300010049 | Bacteria | 1095 |
| 7 | Ga0123356_12010078 | 3300010049 | Bacteria | 721 |
| 8 | Ga0123353_10489666 | 3300010167 | Bacteria | 1796 |
| 9 | Ga0123353_10910240 | 3300010167 | Unclassified | 1196 |
| 10 | Ga0123353_11594421 | 3300010167 | Unclassified | 825 |
| 11 | Ga0123354_10272226 | 3300010882 | Bacteria | 1664 |
| 12 | IMNBL1DRAFT_c0013511 | 3300000062 | Bacteria | 3656 |
| 13 | Ga0160459_107425 | 3300012831 | Bacteria | 1377 |
| 14 | Ga0466657_203405 | 3300042582 | Bacteria | 6735 |
| 15 | Ga0466692_191187 | 3300042591 | Bacteria | 1023 |
| 16 | Ga0466694_060428 | 3300042594 | Bacteria | 2134 |
| 17 | Ga0466701_030599 | 3300042598 | Bacteria | 4831 |
| 18 | Ga0466701_082560 | 3300042598 | Bacteria | 10541 |
| 19 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 20 | Ga0466719_401320 | 3300042606 | Bacteria | 1479 |
| 21 | Ga0466719_468537 | 3300042606 | Bacteria | 80797 |
| 22 | Ga0466702_388408 | 3300042635 | Bacteria | 1709 |
| 23 | Ga0466732_009863 | 3300042656 | Bacteria | 1494 |
| 24 | Ga0466732_299434 | 3300042656 | Bacteria | 1505 |
| 25 | Ga0123355_10617082 | 3300009826 | Bacteria | 1280 |
| 26 | Ga0123356_10459264 | 3300010049 | Unclassified | 1423 |
| 27 | Ga0123356_10973979 | 3300010049 | Bacteria | 1019 |
| 28 | Ga0123353_10002126 | 3300010167 | Bacteria | 24517 |
| 29 | IMNBGM34_c017181 | 3300000036 | Bacteria | 903 |
| 30 | IMNBL1DRAFT_c0000311 | 3300000062 | Bacteria | 41422 |
| 31 | Ga0068305_10073887 | 3300005083 | Bacteria | 1927 |
| 32 | Ga0103268_1018774 | 3300007192 | Unclassified | 1543 |
| 33 | Ga0466710_251017 | 3300042613 | Bacteria | 2155 |
| 34 | Ga0160469_100154 | 3300012824 | Bacteria | 76254 |
| 35 | Ga0160455_100183 | 3300012837 | Bacteria | 61401 |
| 36 | Ga0466694_111997 | 3300042594 | Bacteria | 1610 |
| 37 | Ga0466694_180398 | 3300042594 | Bacteria | 1841 |
| 38 | Ga0466700_003162 | 3300042600 | Bacteria | 3539 |
| 39 | Ga0466700_164676 | 3300042600 | Bacteria | 2894 |
| 40 | Ga0466707_296601 | 3300042601 | Bacteria | 7478 |
| 41 | Ga0466707_354355 | 3300042601 | Bacteria | 49155 |
| 42 | Ga0466713_124336 | 3300042602 | Bacteria | 24023 |
| 43 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 44 | Ga0466717_243810 | 3300042604 | Unclassified | 1133 |
| 45 | Ga0466717_285335 | 3300042604 | Bacteria | 1749 |
| 46 | Ga0466721_136051 | 3300042608 | Bacteria | 1206 |
| 47 | Ga0466698_418342 | 3300042610 | Bacteria | 6626 |
| 48 | Ga0466734_015756 | 3300042623 | Bacteria | 28187 |
| 49 | Ga0466724_03072 | 3300042649 | Bacteria | 18268 |
| 50 | Ga0466725_461929 | 3300042654 | Bacteria | 22391 |
| 51 | Ga0466733_120424 | 3300042659 | Bacteria | 2645 |
| 52 | Ga0123355_10001203 | 3300009826 | Bacteria | 36038 |
| 53 | Ga0123356_10051712 | 3300010049 | Bacteria | 3822 |
| 54 | Ga0123356_11651494 | 3300010049 | Unclassified | 794 |
| 55 | Ga0123353_10673803 | 3300010167 | Bacteria | 1458 |
| 56 | Ga0123354_10433716 | 3300010882 | Bacteria | 1080 |
| 57 | JGI24705J35276_12199368 | 3300002504 | Unclassified | 1584 |
| 58 | Ga0105005_1021830 | 3300007505 | Bacteria | 8863 |
| 59 | Ga0466723_015433 | 3300042618 | Bacteria | 8886 |
| 60 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 61 | Ga0466692_115746 | 3300042591 | Bacteria | 1253 |
| 62 | Ga0466693_027963 | 3300042592 | Bacteria | 4027 |
| 63 | Ga0466691_081749 | 3300042593 | Bacteria | 15757 |
| 64 | Ga0466701_098401 | 3300042598 | Bacteria | 3611 |
| 65 | Ga0466698_066268 | 3300042610 | Bacteria | 6926 |
| 66 | Ga0466697_101971 | 3300042611 | Bacteria | 1665 |
| 67 | Ga0466705_089959 | 3300042612 | Bacteria | 3058 |
| 68 | Ga0123357_10056176 | 3300009784 | Bacteria | 5295 |
| 69 | Ga0123355_10073553 | 3300009826 | Bacteria | 5477 |
| 70 | Ga0123356_10144520 | 3300010049 | Bacteria | 2351 |
| 71 | Ga0123356_11672216 | 3300010049 | Bacteria | 789 |
| 72 | Ga0123353_10056405 | 3300010167 | Bacteria | 6287 |
| 73 | Ga0123353_10406262 | 3300010167 | Bacteria | 2024 |
| 74 | JGI24695J34938_10009199 | 3300002450 | Unclassified | 5516 |
| 75 | JGI24702J35022_10000489 | 3300002462 | Bacteria | 23998 |
| 76 | Ga0466710_199383 | 3300042613 | Bacteria | 1329 |
| 77 | Ga0466715_378047 | 3300042616 | Bacteria | 21549 |
| 78 | Ga0466723_289451 | 3300042618 | Bacteria | 49429 |
| 79 | Ga0466726_079457 | 3300042619 | Bacteria | 4157 |
| 80 | Ga0466726_109190 | 3300042619 | Bacteria | 5348 |
| 81 | Ga0466728_137843 | 3300042620 | Bacteria | 2744 |
| 82 | Ga0160431_100175 | 3300012828 | Bacteria | 44721 |
| 83 | Ga0160472_105816 | 3300012839 | Bacteria | 1923 |
| 84 | Ga0160457_1001220 | 3300012858 | Bacteria | 7723 |
| 85 | Ga0223683_1072936 | 3300021245 | Bacteria | 1119 |
| 86 | Ga0233288_1006034 | 3300022232 | Bacteria | 1595 |
| 87 | Ga0466694_063011 | 3300042594 | Bacteria | 7947 |
| 88 | Ga0466701_101169 | 3300042598 | Bacteria | 66668 |
| 89 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 90 | Ga0466704_367182 | 3300042643 | Bacteria | 14991 |
| 91 | Ga0466724_17202 | 3300042649 | Bacteria | 3672 |
| 92 | Ga0466725_224042 | 3300042654 | Bacteria | 2257 |
| 93 | Ga0466705_325997 | 3300042612 | Bacteria | 31796 |
| 94 | Ga0466733_076918 | 3300042659 | Bacteria | 4299 |
| 95 | Ga0466733_179817 | 3300042659 | Bacteria | 1581 |
| 96 | Ga0123356_10019186 | 3300010049 | Bacteria | 6486 |
| 97 | Ga0123356_10036374 | 3300010049 | Bacteria | 4598 |
| 98 | Ga0123353_10113321 | 3300010167 | Bacteria | 4365 |
| 99 | Ga0123353_10404880 | 3300010167 | Unclassified | 2029 |
| 100 | Ga0123353_10448733 | 3300010167 | Unclassified | 1900 |
| 101 | AustNasuHG_c1007648 | 3300000089 | Unclassified | 3833 |
| 102 | Ga0102739_1013811 | 3300007095 | Unclassified | 1039 |
| 103 | Ga0466723_019869 | 3300042618 | Bacteria | 35706 |
| 104 | Ga0466723_306212 | 3300042618 | Bacteria | 6356 |
| 105 | Ga0466728_444146 | 3300042620 | Bacteria | 1249 |
| 106 | Ga0160470_101175 | 3300012813 | Bacteria | 6868 |
| 107 | Ga0233288_1023764 | 3300022232 | Bacteria | 908 |
| 108 | Ga0466690_208712 | 3300042590 | Bacteria | 16914 |
| 109 | Ga0466691_108606 | 3300042593 | Bacteria | 9393 |
| 110 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 111 | Ga0466717_017183 | 3300042604 | Bacteria | 2585 |
| 112 | Ga0466717_104945 | 3300042604 | Bacteria | 7422 |
| 113 | Ga0466731_248329 | 3300042622 | Bacteria | 5724 |
| 114 | Ga0466735_137752 | 3300042624 | Bacteria | 2919 |
| 115 | Ga0466703_068182 | 3300042636 | Bacteria | 42719 |
| 116 | Ga0466704_201176 | 3300042643 | Bacteria | 27945 |
| 117 | Ga0466708_172769 | 3300042652 | Bacteria | 7449 |
| 118 | Ga0466697_099390 | 3300042611 | Bacteria | 1617 |
| 119 | Ga0466697_223009 | 3300042611 | Bacteria | 1699 |
| 120 | Ga0466733_151623 | 3300042659 | Bacteria | 7663 |
| 121 | Ga0123355_10053144 | 3300009826 | Bacteria | 6569 |
| 122 | Ga0123355_10270893 | 3300009826 | Bacteria | 2359 |
| 123 | Ga0123356_10139456 | 3300010049 | Bacteria | 2390 |
| 124 | Ga0123356_11610380 | 3300010049 | Unclassified | 804 |
| 125 | Ga0123353_10673804 | 3300010167 | Bacteria | 1458 |
| 126 | Ga0123354_10198836 | 3300010882 | Unclassified | 2212 |
| 127 | Ga0123354_10657423 | 3300010882 | Bacteria | 746 |
| 128 | IMNBGM34_c003625 | 3300000036 | Bacteria | 2119 |
| 129 | IMNBGM34_c004877 | 3300000036 | Bacteria | 1797 |
| 130 | Ga0466710_429042 | 3300042613 | Bacteria | 1432 |
| 131 | Ga0466729_108585 | 3300042621 | Bacteria | 3906 |
| 132 | Ga0160468_100431 | 3300012819 | Bacteria | 17464 |
| 133 | Ga0466657_204285 | 3300042582 | Bacteria | 4902 |
| 134 | Ga0466694_312337 | 3300042594 | Bacteria | 5792 |
| 135 | Ga0466700_283432 | 3300042600 | Bacteria | 2095 |
| 136 | Ga0466716_032863 | 3300042605 | Bacteria | 2255 |
| 137 | Ga0466731_016159 | 3300042622 | Bacteria | 48336 |
| 138 | Ga0466731_334150 | 3300042622 | Bacteria | 2330 |
| 139 | Ga0466702_445943 | 3300042635 | Unclassified | 1559 |
| 140 | Ga0466724_66981 | 3300042649 | Bacteria | 17748 |
| 141 | Ga0123357_10665868 | 3300009784 | Unclassified | 763 |
| 142 | Ga0123356_10460412 | 3300010049 | Bacteria | 1421 |
| 143 | Ga0123356_11974644 | 3300010049 | Bacteria | 727 |
| 144 | Ga0123353_10138080 | 3300010167 | Bacteria | 3908 |
| 145 | Ga0123354_10308507 | 3300010882 | Bacteria | 1483 |
| 146 | Ga0160464_113521 | 3300012805 | Bacteria | 616 |
| 147 | JGI24702J35022_10044638 | 3300002462 | Bacteria | 2362 |
| 148 | Ga0103263_101903 | 3300007042 | Bacteria | 2647 |
| 149 | Ga0102740_1000340 | 3300007140 | Bacteria | 13154 |
| 150 | Ga0105005_1121158 | 3300007505 | Unclassified | 2543 |
| 151 | Ga0466710_128288 | 3300042613 | Unclassified | 1534 |
| 152 | Ga0466729_144169 | 3300042621 | Bacteria | 1089 |
| 153 | Ga0160468_105537 | 3300012819 | Bacteria | 1427 |
| 154 | Ga0160441_100013 | 3300012825 | Bacteria | 353830 |
| 155 | Ga0160457_1000216 | 3300012858 | Bacteria | 43789 |
| 156 | Ga0466693_428138 | 3300042592 | Bacteria | 5450 |
| 157 | Ga0466694_061306 | 3300042594 | Bacteria | 1086 |
| 158 | Ga0466695_098343 | 3300042595 | Bacteria | 1755 |
| 159 | Ga0466696_412028 | 3300042596 | Bacteria | 31787 |
| 160 | Ga0466706_122919 | 3300042599 | Bacteria | 1762 |
| 161 | Ga0466707_290813 | 3300042601 | Bacteria | 7513 |
| 162 | Ga0466717_137120 | 3300042604 | Bacteria | 2927 |
| 163 | Ga0466721_390986 | 3300042608 | Bacteria | 1091 |
| 164 | Ga0466734_119789 | 3300042623 | Bacteria | 17928 |
| 165 | Ga0466724_47248 | 3300042649 | Bacteria | 1146 |
| 166 | Ga0466725_380667 | 3300042654 | Bacteria | 5631 |
| 167 | Ga0466705_221348 | 3300042612 | Unclassified | 3919 |
| 168 | Ga0123355_10008401 | 3300009826 | Bacteria | 15608 |
| 169 | Ga0123353_10026029 | 3300010167 | Bacteria | 8926 |
| 170 | Ga0123353_10244935 | 3300010167 | Bacteria | 2782 |
| 171 | Ga0160465_100054 | 3300012803 | Bacteria | 130977 |
| 172 | IMNBL1DRAFT_c0013028 | 3300000062 | Bacteria | 3760 |
| 173 | JGI24705J35276_12144886 | 3300002504 | Bacteria | 1157 |
| 174 | JGI24696J40584_12951634 | 3300002834 | Bacteria | 2263 |
| 175 | CVPL010W_10000676 | 3300002931 | Bacteria | 64066 |
| 176 | Ga0105005_1104662 | 3300007505 | Bacteria | 2954 |
| 177 | Ga0466723_309299 | 3300042618 | Bacteria | 8426 |
| 178 | Ga0466729_064368 | 3300042621 | Bacteria | 15899 |
| 179 | Ga0160472_110190 | 3300012839 | Bacteria | 1171 |
| 180 | Ga0160447_100004 | 3300012849 | Bacteria | 554359 |
| 181 | Ga0466701_025996 | 3300042598 | Bacteria | 29910 |
| 182 | Ga0466713_056506 | 3300042602 | Bacteria | 16973 |
| 183 | Ga0466713_100023 | 3300042602 | Bacteria | 4216 |
| 184 | Ga0466717_290438 | 3300042604 | Bacteria | 1208 |
| 185 | Ga0466717_309442 | 3300042604 | Bacteria | 3604 |
| 186 | Ga0466698_094276 | 3300042610 | Bacteria | 4974 |
| 187 | Ga0466735_196613 | 3300042624 | Bacteria | 7717 |
| 188 | Ga0466730_053826 | 3300042625 | Bacteria | 92011 |
| 189 | Ga0466709_095111 | 3300042648 | Bacteria | 17483 |
| 190 | Ga0466709_218885 | 3300042648 | Bacteria | 3409 |
| 191 | Ga0466724_28405 | 3300042649 | Bacteria | 7792 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 22 | 94 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.