Protein Family IF02708
Metagenome
Isolate
212
Members
62
Samples
195
Scaffolds
323.41
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10016853|Ga0123356_100168533
- Length
- 384 aa
- Sequence
- LAFYVNFIKKVKIWAILRGKSMVKPYYLAPMAELSHRALRTLIEEFGGCDGYFSEMISAPALLAGGPFEKWYIDAAPRPEKCIFQLVGAACESLSKAAAYLDGLECAGIDINMGCSAPLIRKTGAGAAWMASIDRAGELISCVRPYVKRRLSVKLRIGFKEDFEYLVRFCRRLEEEGVEMITLHPRTVMEKFKRLARWEYIGKLKNELKIPVTGNGDISNAGELVQRAAGPCDAVMIGRAAVRQPWIFAQARAGEQNLNNAKVSTHTEAAHVPEKLSLEFSAGGDLRLPRRIPPKVFSGREQMPYEEIGLRFIELLAEHQPFEFHISRARRFFGFFCDNLKWGNYLKNQLNKEETLSGIERVWQNFFKEGLDDTVPDSHQENP*
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Unclassified
30.5%
Kalotermitidae
22.0%
Rhinotermitidae
6.8%
Termopsidae
3.4%
Taxonomy
Archaea
1
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 24 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 31 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 49 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 50 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 51 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 52 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 53 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 54 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 55 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 56 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 57 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 58 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_092373 | 3300038395 | Bacteria | 2954 |
| 2 | Ga0466692_021300 | 3300042591 | Bacteria | 25960 |
| 3 | Ga0466692_192513 | 3300042591 | Bacteria | 4870 |
| 4 | Ga0466691_066696 | 3300042593 | Bacteria | 16106 |
| 5 | Ga0466699_135266 | 3300042597 | Bacteria | 4296 |
| 6 | Ga0466712_078232 | 3300042614 | Bacteria | 13492 |
| 7 | Ga0466723_017538 | 3300042618 | Bacteria | 34729 |
| 8 | Ga0466735_107152 | 3300042624 | Bacteria | 22901 |
| 9 | Ga0466704_059111 | 3300042643 | Bacteria | 12430 |
| 10 | Ga0466709_291476 | 3300042648 | Bacteria | 4707 |
| 11 | JGI24698J34947_10000352 | 3300002449 | Bacteria | 20514 |
| 12 | JGI24698J34947_10016051 | 3300002449 | Bacteria | 4071 |
| 13 | JGI24695J34938_10000406 | 3300002450 | Bacteria | 41980 |
| 14 | JGI24695J34938_10002571 | 3300002450 | Bacteria | 13683 |
| 15 | Ga0072941_1058060 | 3300005201 | Bacteria | 3969 |
| 16 | Ga0466719_127511 | 3300042606 | Bacteria | 1334 |
| 17 | Ga0466698_315213 | 3300042610 | Bacteria | 3863 |
| 18 | Ga0466692_003325 | 3300042591 | Bacteria | 7132 |
| 19 | Ga0466699_144592 | 3300042597 | Bacteria | 2912 |
| 20 | Ga0466699_251524 | 3300042597 | Bacteria | 3718 |
| 21 | Ga0466712_001541 | 3300042614 | Bacteria | 16481 |
| 22 | Ga0466712_011061 | 3300042614 | Bacteria | 35143 |
| 23 | Ga0466712_097785 | 3300042614 | Bacteria | 2336 |
| 24 | Ga0466712_119671 | 3300042614 | Bacteria | 15965 |
| 25 | Ga0466712_229487 | 3300042614 | Bacteria | 3320 |
| 26 | Ga0466711_034353 | 3300042615 | Bacteria | 11825 |
| 27 | Ga0466715_200314 | 3300042616 | Bacteria | 25554 |
| 28 | Ga0466718_032525 | 3300042617 | Bacteria | 4008 |
| 29 | Ga0466718_107415 | 3300042617 | Unclassified | 4062 |
| 30 | Ga0466718_167494 | 3300042617 | Bacteria | 2709 |
| 31 | Ga0466726_228225 | 3300042619 | Bacteria | 5494 |
| 32 | Ga0466726_273218 | 3300042619 | Bacteria | 10389 |
| 33 | Ga0466702_250082 | 3300042635 | Bacteria | 2375 |
| 34 | Ga0466702_362935 | 3300042635 | Bacteria | 2113 |
| 35 | Ga0466708_264348 | 3300042652 | Bacteria | 6966 |
| 36 | Ga0123355_10316956 | 3300009826 | Bacteria | 2106 |
| 37 | Ga0123356_10000046 | 3300010049 | Bacteria | 130593 |
| 38 | Ga0123356_10033716 | 3300010049 | Bacteria | 4788 |
| 39 | JGI24698J34947_10013507 | 3300002449 | Bacteria | 4456 |
| 40 | JGI24695J34938_10001739 | 3300002450 | Bacteria | 18011 |
| 41 | Ga0072941_1005610 | 3300005201 | Bacteria | 18620 |
| 42 | Ga0074263_109196 | 3300005485 | Bacteria | 2648 |
| 43 | Ga0466719_244915 | 3300042606 | Bacteria | 1430 |
| 44 | Ga0466720_052956 | 3300042607 | Unclassified | 6075 |
| 45 | Ga0466720_178468 | 3300042607 | Bacteria | 9406 |
| 46 | Ga0466721_044195 | 3300042608 | Bacteria | 2977 |
| 47 | Ga0466722_238428 | 3300042609 | Bacteria | 2806 |
| 48 | Ga0466698_121989 | 3300042610 | Bacteria | 11045 |
| 49 | Ga0466690_218524 | 3300042590 | Bacteria | 2380 |
| 50 | Ga0466694_027819 | 3300042594 | Bacteria | 46301 |
| 51 | Ga0466694_361139 | 3300042594 | Unclassified | 2026 |
| 52 | Ga0466696_452719 | 3300042596 | Bacteria | 2632 |
| 53 | Ga0466712_005884 | 3300042614 | Bacteria | 7995 |
| 54 | Ga0466723_088236 | 3300042618 | Bacteria | 5604 |
| 55 | Ga0466723_135084 | 3300042618 | Bacteria | 12031 |
| 56 | Ga0466703_012549 | 3300042636 | Bacteria | 2773 |
| 57 | Ga0466703_212383 | 3300042636 | Bacteria | 15812 |
| 58 | Ga0466704_232260 | 3300042643 | Bacteria | 55610 |
| 59 | Ga0123356_10000102 | 3300010049 | Bacteria | 90045 |
| 60 | Ga0123356_10016472 | 3300010049 | Bacteria | 7051 |
| 61 | Ga0123356_10028211 | 3300010049 | Bacteria | 5259 |
| 62 | JGI24698J34947_10001545 | 3300002449 | Bacteria | 12179 |
| 63 | JGI24695J34938_10002722 | 3300002450 | Bacteria | 13040 |
| 64 | JGI24695J34938_10009308 | 3300002450 | Bacteria | 5473 |
| 65 | JGI24695J34938_10024494 | 3300002450 | Bacteria | 2898 |
| 66 | Ga0072940_1119894 | 3300005200 | Bacteria | 1373 |
| 67 | Ga0072941_1006597 | 3300005201 | Bacteria | 23647 |
| 68 | Ga0072941_1083622 | 3300005201 | Bacteria | 4117 |
| 69 | Ga0466719_266215 | 3300042606 | Bacteria | 2079 |
| 70 | Ga0466722_092793 | 3300042609 | Bacteria | 6853 |
| 71 | Ga0264413_143092 | 3300024493 | Bacteria | 1506 |
| 72 | Ga0466694_199384 | 3300042594 | Bacteria | 4249 |
| 73 | Ga0466712_024203 | 3300042614 | Bacteria | 3235 |
| 74 | Ga0466712_027847 | 3300042614 | Bacteria | 1427 |
| 75 | Ga0466718_076723 | 3300042617 | Bacteria | 7356 |
| 76 | Ga0466726_218849 | 3300042619 | Bacteria | 3524 |
| 77 | Ga0466728_122351 | 3300042620 | Bacteria | 18541 |
| 78 | Ga0466702_192903 | 3300042635 | Bacteria | 8420 |
| 79 | Ga0466703_215869 | 3300042636 | Bacteria | 12150 |
| 80 | Ga0466704_143462 | 3300042643 | Bacteria | 12251 |
| 81 | Ga0466708_106185 | 3300042652 | Bacteria | 9454 |
| 82 | Ga0123356_10002761 | 3300010049 | Bacteria | 18643 |
| 83 | JGI24698J34947_10000090 | 3300002449 | Bacteria | 30429 |
| 84 | JGI24698J34947_10008305 | 3300002449 | Bacteria | 5694 |
| 85 | JGI24698J34947_10023384 | 3300002449 | Bacteria | 3307 |
| 86 | JGI24695J34938_10000605 | 3300002450 | Bacteria | 34496 |
| 87 | JGI24695J34938_10001131 | 3300002450 | Bacteria | 23893 |
| 88 | JGI24695J34938_10019241 | 3300002450 | Bacteria | 3391 |
| 89 | Ga0072941_1016611 | 3300005201 | Bacteria | 7263 |
| 90 | Ga0466707_103380 | 3300042601 | Bacteria | 1887 |
| 91 | Ga0264413_103055 | 3300024493 | Bacteria | 33073 |
| 92 | Ga0264413_104941 | 3300024493 | Bacteria | 8018 |
| 93 | Ga0456237_0000592 | 3300041968 | Bacteria | 5527 |
| 94 | Ga0466691_141189 | 3300042593 | Bacteria | 24648 |
| 95 | Ga0466696_020956 | 3300042596 | Bacteria | 9641 |
| 96 | Ga0466705_412504 | 3300042612 | Bacteria | 25058 |
| 97 | Ga0466712_035207 | 3300042614 | Bacteria | 27664 |
| 98 | Ga0466715_076024 | 3300042616 | Bacteria | 3121 |
| 99 | Ga0466718_062829 | 3300042617 | Bacteria | 11427 |
| 100 | Ga0466723_010444 | 3300042618 | Bacteria | 8730 |
| 101 | Ga0466728_239082 | 3300042620 | Bacteria | 8847 |
| 102 | Ga0466702_461571 | 3300042635 | Bacteria | 3355 |
| 103 | Ga0466704_299027 | 3300042643 | Bacteria | 21345 |
| 104 | Ga0123356_10001661 | 3300010049 | Bacteria | 24345 |
| 105 | Ga0123353_10133683 | 3300010167 | Bacteria | 3979 |
| 106 | 2230929932 | 2228664001 | Bacteria | 12280 |
| 107 | FAAS_10001086 | 3300001880 | Bacteria | 1123 |
| 108 | JGI24698J34947_10067067 | 3300002449 | Bacteria | 1743 |
| 109 | JGI24695J34938_10000790 | 3300002450 | Bacteria | 29511 |
| 110 | JGI24695J34938_10004544 | 3300002450 | Bacteria | 9046 |
| 111 | JGI24695J34938_10005703 | 3300002450 | Bacteria | 7686 |
| 112 | JGI24695J34938_10026015 | 3300002450 | Bacteria | 2787 |
| 113 | JGI24695J34938_10027843 | 3300002450 | Bacteria | 2665 |
| 114 | Ga0072941_1016612 | 3300005201 | Bacteria | 9052 |
| 115 | Ga0072941_1021001 | 3300005201 | Bacteria | 8666 |
| 116 | Ga0466719_146577 | 3300042606 | Bacteria | 11524 |
| 117 | Ga0466720_086674 | 3300042607 | Bacteria | 26644 |
| 118 | Ga0466722_024014 | 3300042609 | Bacteria | 13213 |
| 119 | Ga0466722_094066 | 3300042609 | Bacteria | 3000 |
| 120 | Ga0466705_133616 | 3300042612 | Bacteria | 12320 |
| 121 | Ga0466732_028317 | 3300042656 | Bacteria | 7961 |
| 122 | Ga0264413_103730 | 3300024493 | Bacteria | 3894 |
| 123 | Ga0264413_104943 | 3300024493 | Bacteria | 2093 |
| 124 | Ga0466692_146597 | 3300042591 | Bacteria | 5961 |
| 125 | Ga0466693_396739 | 3300042592 | Bacteria | 19040 |
| 126 | Ga0466699_103551 | 3300042597 | Bacteria | 3812 |
| 127 | Ga0466699_308534 | 3300042597 | Bacteria | 19289 |
| 128 | Ga0466699_382697 | 3300042597 | Bacteria | 1363 |
| 129 | Ga0466712_030029 | 3300042614 | Bacteria | 7731 |
| 130 | Ga0466712_103721 | 3300042614 | Bacteria | 4046 |
| 131 | Ga0466712_160590 | 3300042614 | Bacteria | 6573 |
| 132 | Ga0466729_134958 | 3300042621 | Bacteria | 2046 |
| 133 | Ga0466702_131138 | 3300042635 | Bacteria | 32512 |
| 134 | Ga0466708_011223 | 3300042652 | Bacteria | 6302 |
| 135 | Ga0466708_033516 | 3300042652 | Bacteria | 3917 |
| 136 | Ga0466708_073305 | 3300042652 | Bacteria | 2347 |
| 137 | Ga0123356_10016853 | 3300010049 | Bacteria | 6964 |
| 138 | Ga0123356_10036546 | 3300010049 | Bacteria | 4586 |
| 139 | JGI24698J34947_10001739 | 3300002449 | Bacteria | 11615 |
| 140 | JGI24698J34947_10021568 | 3300002449 | Bacteria | 3461 |
| 141 | JGI24698J34947_10043588 | 3300002449 | Bacteria | 2300 |
| 142 | JGI24698J34947_10049936 | 3300002449 | Bacteria | 2111 |
| 143 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 144 | JGI24695J34938_10000053 | 3300002450 | Bacteria | 90544 |
| 145 | JGI24695J34938_10000694 | 3300002450 | Bacteria | 31746 |
| 146 | JGI24695J34938_10011109 | 3300002450 | Bacteria | 4874 |
| 147 | JGI24695J34938_10018820 | 3300002450 | Bacteria | 3439 |
| 148 | JGI24695J34938_10088461 | 3300002450 | Bacteria | 1272 |
| 149 | Ga0072940_1063486 | 3300005200 | Bacteria | 1684 |
| 150 | Ga0466722_085930 | 3300042609 | Bacteria | 2681 |
| 151 | Ga0466722_124237 | 3300042609 | Bacteria | 22625 |
| 152 | Ga0466693_200985 | 3300042592 | Bacteria | 3968 |
| 153 | Ga0466693_326837 | 3300042592 | Bacteria | 3751 |
| 154 | Ga0466694_142529 | 3300042594 | Bacteria | 2650 |
| 155 | Ga0466694_212373 | 3300042594 | Bacteria | 1676 |
| 156 | Ga0466699_303498 | 3300042597 | Unclassified | 1311 |
| 157 | Ga0466699_372136 | 3300042597 | Bacteria | 2228 |
| 158 | Ga0466711_014343 | 3300042615 | Bacteria | 4453 |
| 159 | Ga0466715_205671 | 3300042616 | Bacteria | 6319 |
| 160 | Ga0466723_009551 | 3300042618 | Bacteria | 2449 |
| 161 | Ga0466702_122037 | 3300042635 | Bacteria | 1503 |
| 162 | Ga0466702_368466 | 3300042635 | Bacteria | 1455 |
| 163 | Ga0466703_272735 | 3300042636 | Bacteria | 12610 |
| 164 | Ga0123356_10001149 | 3300010049 | Bacteria | 29280 |
| 165 | Ga0123356_10192365 | 3300010049 | Bacteria | 2072 |
| 166 | AustNasuHG_c1009245 | 3300000089 | Bacteria | 3462 |
| 167 | JGI24698J34947_10006019 | 3300002449 | Bacteria | 6660 |
| 168 | JGI24695J34938_10002398 | 3300002450 | Bacteria | 14403 |
| 169 | JGI24695J34938_10003399 | 3300002450 | Bacteria | 11167 |
| 170 | JGI24695J34938_10049369 | 3300002450 | Bacteria | 1849 |
| 171 | Ga0072941_1078219 | 3300005201 | Bacteria | 1969 |
| 172 | Ga0466720_109213 | 3300042607 | Bacteria | 1145 |
| 173 | Ga0466722_052856 | 3300042609 | Bacteria | 20233 |
| 174 | Ga0466722_165275 | 3300042609 | Bacteria | 2205 |
| 175 | Ga0264413_104944 | 3300024493 | Bacteria | 6343 |
| 176 | Ga0264413_105061 | 3300024493 | Bacteria | 5102 |
| 177 | Ga0264413_110613 | 3300024493 | Bacteria | 2872 |
| 178 | Ga0466690_301643 | 3300042590 | Bacteria | 2762 |
| 179 | Ga0466690_406828 | 3300042590 | Bacteria | 9118 |
| 180 | Ga0466691_147726 | 3300042593 | Bacteria | 12376 |
| 181 | Ga0466699_096964 | 3300042597 | Bacteria | 5489 |
| 182 | Ga0466699_098650 | 3300042597 | Bacteria | 4959 |
| 183 | Ga0466718_122292 | 3300042617 | Bacteria | 8431 |
| 184 | Ga0466718_165022 | 3300042617 | Bacteria | 4955 |
| 185 | Ga0466731_299980 | 3300042622 | Bacteria | 1420 |
| 186 | Ga0466702_020119 | 3300042635 | Bacteria | 5491 |
| 187 | Ga0123356_10013724 | 3300010049 | Bacteria | 7805 |
| 188 | Ga0123356_10268180 | 3300010049 | Bacteria | 1795 |
| 189 | Ga0123353_10211299 | 3300010167 | Bacteria | 3043 |
| 190 | Ga0123353_10431086 | 3300010167 | Bacteria | 1950 |
| 191 | Ga0123354_10427191 | 3300010882 | Archaea | 1095 |
| 192 | JGI24698J34947_10032709 | 3300002449 | Bacteria | 2729 |
| 193 | JGI24695J34938_10002666 | 3300002450 | Bacteria | 13311 |
| 194 | JGI24695J34938_10075803 | 3300002450 | Bacteria | 1397 |
| 195 | Ga0466720_012772 | 3300042607 | Bacteria | 14217 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01207 | Dus | Dihydrouridine synthase (Dus) | 28 | 275 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.