Protein Family IF02706
Metagenome
Metatranscriptome
Isolate
126
Members
41
Samples
119
Scaffolds
96.39
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10015922|Ga0123356_100159227
- Length
- 103 aa
- Sequence
- MEMRECMLVLITYDVNTETPEGRKRLRRVSKACQNYGQRVQNSVFECEVDAGQLLKVKDRLVRLINSETDSLRFYNLGNNSKDKVEHFGAKPSFSVSEPLIV*
Sample Types
Isolate
5.6%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
2.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.7%
Unclassified
23.1%
Kalotermitidae
20.5%
Passalidae
2.6%
Hodotermitidae
2.6%
Termopsidae
2.6%
Taxonomy
Archaea
1
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 3 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 9 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 10 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 28 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 29 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 34 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10205717 | 3300009826 | Unclassified | 2865 |
| 2 | Ga0123355_10691566 | 3300009826 | Bacteria | 1174 |
| 3 | Ga0123356_10015922 | 3300010049 | Bacteria | 7194 |
| 4 | Ga0123356_10785224 | 3300010049 | Bacteria | 1123 |
| 5 | Ga0123356_10920626 | 3300010049 | Bacteria | 1045 |
| 6 | Ga0123353_10313143 | 3300010167 | Bacteria | 2387 |
| 7 | Ga0123353_13185631 | 3300010167 | Bacteria | 526 |
| 8 | Ga0123353_13232724 | 3300010167 | Bacteria | 521 |
| 9 | Ga0123354_10275095 | 3300010882 | Bacteria | 1648 |
| 10 | Ga0123354_10485044 | 3300010882 | Bacteria | 975 |
| 11 | JGI24696J40584_12960660 | 3300002834 | Bacteria | 7945 |
| 12 | Ga0466706_130681 | 3300042599 | Bacteria | 11480 |
| 13 | Ga0466718_125121 | 3300042617 | Bacteria | 2702 |
| 14 | Ga0123353_10120480 | 3300010167 | Bacteria | 4219 |
| 15 | Ga0123353_10366711 | 3300010167 | Bacteria | 2161 |
| 16 | Ga0123353_10826221 | 3300010167 | Unclassified | 1275 |
| 17 | Ga0123353_10931925 | 3300010167 | Bacteria | 1178 |
| 18 | Ga0123353_11908529 | 3300010167 | Bacteria | 732 |
| 19 | Ga0123353_11987378 | 3300010167 | Bacteria | 713 |
| 20 | JGI24700J35501_10930414 | 3300002508 | Bacteria | 13771 |
| 21 | Ga0466706_130428 | 3300042599 | Bacteria | 1975 |
| 22 | Ga0466721_346009 | 3300042608 | Bacteria | 1522 |
| 23 | Ga0466715_388593 | 3300042616 | Bacteria | 6470 |
| 24 | Ga0466723_346829 | 3300042618 | Bacteria | 1164 |
| 25 | Ga0123357_10281015 | 3300009784 | Unclassified | 1719 |
| 26 | Ga0123353_10165029 | 3300010167 | Bacteria | 3522 |
| 27 | Ga0123353_11030622 | 3300010167 | Bacteria | 1102 |
| 28 | Ga0123353_11032545 | 3300010167 | Bacteria | 1100 |
| 29 | Ga0123353_11710238 | 3300010167 | Bacteria | 787 |
| 30 | Ga0123353_11875592 | 3300010167 | Bacteria | 741 |
| 31 | Ga0123354_10696463 | 3300010882 | Unclassified | 711 |
| 32 | JGI24702J35022_10000074 | 3300002462 | Bacteria | 43914 |
| 33 | Ga0466714_045797 | 3300042603 | Bacteria | 3806 |
| 34 | Ga0466704_398985 | 3300042643 | Bacteria | 1142 |
| 35 | Ga0466705_409262 | 3300042612 | Bacteria | 106060 |
| 36 | Ga0466718_167941 | 3300042617 | Bacteria | 1343 |
| 37 | Ga0466696_174341 | 3300042596 | Bacteria | 1861 |
| 38 | Ga0466705_054143 | 3300042612 | Bacteria | 1758 |
| 39 | Ga0123355_10021520 | 3300009826 | Bacteria | 10321 |
| 40 | Ga0123356_10710158 | 3300010049 | Bacteria | 1175 |
| 41 | Ga0123356_14047237 | 3300010049 | Unclassified | 505 |
| 42 | Ga0123353_10233070 | 3300010167 | Bacteria | 2868 |
| 43 | Ga0123353_10474710 | 3300010167 | Bacteria | 1832 |
| 44 | Ga0123353_10800366 | 3300010167 | Bacteria | 1302 |
| 45 | Ga0123353_10992715 | 3300010167 | Bacteria | 1129 |
| 46 | Ga0123353_11972067 | 3300010167 | Bacteria | 717 |
| 47 | Ga0123353_12423920 | 3300010167 | Bacteria | 627 |
| 48 | Ga0123353_13108959 | 3300010167 | Bacteria | 534 |
| 49 | Ga0123353_13334475 | 3300010167 | Bacteria | 511 |
| 50 | Ga0123354_10320551 | 3300010882 | Bacteria | 1431 |
| 51 | IMNBL1DRAFT_c0003066 | 3300000062 | Bacteria | 11033 |
| 52 | Ga0466700_006285 | 3300042600 | Bacteria | 1259 |
| 53 | Ga0466713_044519 | 3300042602 | Bacteria | 3927 |
| 54 | Ga0466714_060446 | 3300042603 | Bacteria | 2754 |
| 55 | Ga0123357_10866725 | 3300009784 | Bacteria | 592 |
| 56 | Ga0123356_10362519 | 3300010049 | Archaea | 1577 |
| 57 | Ga0123356_11362969 | 3300010049 | Bacteria | 871 |
| 58 | Ga0123353_10055473 | 3300010167 | Bacteria | 6340 |
| 59 | Ga0123353_10389255 | 3300010167 | Bacteria | 2081 |
| 60 | Ga0123353_10832797 | 3300010167 | Bacteria | 1268 |
| 61 | Ga0123353_10909675 | 3300010167 | Bacteria | 1197 |
| 62 | Ga0123353_11645054 | 3300010167 | Bacteria | 808 |
| 63 | Ga0123353_12249457 | 3300010167 | Bacteria | 658 |
| 64 | Ga0466706_076761 | 3300042599 | Bacteria | 1113 |
| 65 | Ga0466704_522892 | 3300042643 | Unclassified | 1303 |
| 66 | Ga0466727_196782 | 3300042655 | Bacteria | 1306 |
| 67 | Ga0466711_119223 | 3300042615 | Bacteria | 5527 |
| 68 | Ga0255809_1021659 | 3300022820 | Bacteria | 1283 |
| 69 | Ga0466733_144385 | 3300042659 | Bacteria | 10885 |
| 70 | Ga0123355_10003545 | 3300009826 | Bacteria | 22419 |
| 71 | Ga0123355_10003856 | 3300009826 | Bacteria | 21691 |
| 72 | Ga0123355_10007403 | 3300009826 | Bacteria | 16442 |
| 73 | Ga0123356_10450079 | 3300010049 | Bacteria | 1436 |
| 74 | Ga0123353_10136623 | 3300010167 | Bacteria | 3932 |
| 75 | Ga0123353_10185483 | 3300010167 | Bacteria | 3290 |
| 76 | Ga0123353_10190065 | 3300010167 | Bacteria | 3242 |
| 77 | Ga0123353_10301857 | 3300010167 | Bacteria | 2443 |
| 78 | Ga0123353_11170032 | 3300010167 | Bacteria | 1013 |
| 79 | Ga0123353_12263940 | 3300010167 | Bacteria | 655 |
| 80 | Ga0123353_12463284 | 3300010167 | Bacteria | 620 |
| 81 | Ga0123354_10762479 | 3300010882 | Bacteria | 660 |
| 82 | Ga0466713_141241 | 3300042602 | Bacteria | 17408 |
| 83 | Ga0466714_008712 | 3300042603 | Bacteria | 1070 |
| 84 | Ga0466730_070484 | 3300042625 | Bacteria | 1327 |
| 85 | Ga0466703_010038 | 3300042636 | Bacteria | 2856 |
| 86 | Ga0466703_011086 | 3300042636 | Bacteria | 3142 |
| 87 | Ga0223675_1051681 | 3300021237 | Bacteria | 1058 |
| 88 | Ga0466693_273191 | 3300042592 | Bacteria | 2477 |
| 89 | Ga0466694_366158 | 3300042594 | Unclassified | 1359 |
| 90 | Ga0466696_003611 | 3300042596 | Bacteria | 1148 |
| 91 | Ga0123355_10000364 | 3300009826 | Bacteria | 58670 |
| 92 | Ga0123355_10013809 | 3300009826 | Bacteria | 12587 |
| 93 | Ga0123355_10416024 | 3300009826 | Bacteria | 1722 |
| 94 | Ga0123353_10035418 | 3300010167 | Bacteria | 7803 |
| 95 | Ga0123353_11119730 | 3300010167 | Bacteria | 1043 |
| 96 | Ga0123353_12059123 | 3300010167 | Bacteria | 697 |
| 97 | Ga0123353_12601836 | 3300010167 | Bacteria | 599 |
| 98 | Ga0123353_12912568 | 3300010167 | Bacteria | 557 |
| 99 | Ga0123353_12954207 | 3300010167 | Bacteria | 552 |
| 100 | Ga0123354_10265103 | 3300010882 | Bacteria | 1705 |
| 101 | Ga0123354_10752249 | 3300010882 | Bacteria | 667 |
| 102 | Ga0466714_164554 | 3300042603 | Bacteria | 5586 |
| 103 | Ga0466725_120042 | 3300042654 | Bacteria | 1214 |
| 104 | Ga0466690_237803 | 3300042590 | Bacteria | 3772 |
| 105 | Ga0123355_11096641 | 3300009826 | Bacteria | 829 |
| 106 | Ga0123353_10078314 | 3300010167 | Bacteria | 5312 |
| 107 | Ga0123353_10283000 | 3300010167 | Bacteria | 2545 |
| 108 | Ga0123353_10839352 | 3300010167 | Bacteria | 1261 |
| 109 | Ga0123353_11023137 | 3300010167 | Bacteria | 1107 |
| 110 | Ga0123353_11971957 | 3300010167 | Bacteria | 717 |
| 111 | Ga0123353_12081966 | 3300010167 | Bacteria | 692 |
| 112 | Ga0123354_10351040 | 3300010882 | Bacteria | 1315 |
| 113 | JGI24696J40584_12417899 | 3300002834 | Bacteria | 562 |
| 114 | Ga0072941_1189916 | 3300005201 | Bacteria | 1565 |
| 115 | Ga0466706_069049 | 3300042599 | Bacteria | 15034 |
| 116 | Ga0466707_167552 | 3300042601 | Bacteria | 4182 |
| 117 | Ga0466714_033304 | 3300042603 | Bacteria | 1378 |
| 118 | Ga0255809_1018995 | 3300022820 | Bacteria | 670 |
| 119 | Ga0415639_060775 | 3300038395 | Bacteria | 3956 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09827 | CRISPR_Cas2 | CRISPR associated protein Cas2 | 7 | 84 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.