Protein Family IF02704
Metagenome
Isolate
156
Members
52
Samples
146
Scaffolds
153.56
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10014421|Ga0123356_100144214
- Length
- 175 aa
- Sequence
- MDDKFFLLMVDKFNSSNIAEMDFNDGNMRLLLRKESAFKQITTAAGENKIPAIPNVPTQPIQNSSVHLGITARETSLHNAQALGKDSGGVATLADGERIKSPIVATFYSSPSPDAPAFVKPGAKVKAGQTLCILEAMKMMNHLEAEFDCEIIEVLASSGDLIEYGQEIFTVKRN*
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.5%
Kalotermitidae
26.9%
Unclassified
21.2%
Termopsidae
7.7%
Rhinotermitidae
5.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 2 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 5 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 29 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_238491 | 3300042612 | Bacteria | 1988 |
| 2 | Ga0466706_143199 | 3300042599 | Bacteria | 4052 |
| 3 | Ga0466707_209358 | 3300042601 | Bacteria | 1832 |
| 4 | Ga0466716_330766 | 3300042605 | Bacteria | 1583 |
| 5 | Ga0466716_384615 | 3300042605 | Bacteria | 5767 |
| 6 | Ga0466722_200710 | 3300042609 | Bacteria | 2207 |
| 7 | Ga0466698_176372 | 3300042610 | Bacteria | 1007 |
| 8 | Ga0123355_10764713 | 3300009826 | Bacteria | 1088 |
| 9 | Ga0466709_364674 | 3300042648 | Bacteria | 10271 |
| 10 | Ga0466715_058177 | 3300042616 | Bacteria | 5886 |
| 11 | Ga0466715_431526 | 3300042616 | Bacteria | 2585 |
| 12 | Ga0466723_159001 | 3300042618 | Bacteria | 43446 |
| 13 | Ga0466728_104732 | 3300042620 | Bacteria | 2375 |
| 14 | JGI24695J34938_10001740 | 3300002450 | Bacteria | 18007 |
| 15 | JGI24695J34938_10017199 | 3300002450 | Bacteria | 3652 |
| 16 | Ga0466706_154552 | 3300042599 | Bacteria | 1227 |
| 17 | Ga0466707_294118 | 3300042601 | Bacteria | 1288 |
| 18 | Ga0466716_088200 | 3300042605 | Bacteria | 7857 |
| 19 | Ga0466721_296532 | 3300042608 | Bacteria | 1392 |
| 20 | Ga0456237_0001541 | 3300041968 | Bacteria | 3680 |
| 21 | Ga0466690_375286 | 3300042590 | Bacteria | 2078 |
| 22 | Ga0466696_009122 | 3300042596 | Bacteria | 1778 |
| 23 | Ga0123357_10059937 | 3300009784 | Bacteria | 5107 |
| 24 | Ga0123356_11281003 | 3300010049 | Bacteria | 897 |
| 25 | Ga0123356_13723199 | 3300010049 | Bacteria | 527 |
| 26 | Ga0123353_10966442 | 3300010167 | Bacteria | 1150 |
| 27 | Ga0466708_199326 | 3300042652 | Bacteria | 19137 |
| 28 | Ga0466708_389929 | 3300042652 | Bacteria | 7279 |
| 29 | Ga0466711_502648 | 3300042615 | Bacteria | 8339 |
| 30 | Ga0466715_408367 | 3300042616 | Bacteria | 7322 |
| 31 | JGI24695J34938_10004137 | 3300002450 | Bacteria | 9654 |
| 32 | JGI24695J34938_10011125 | 3300002450 | Bacteria | 4870 |
| 33 | JGI24695J34938_10219917 | 3300002450 | Bacteria | 797 |
| 34 | Ga0072940_1055258 | 3300005200 | Bacteria | 935 |
| 35 | Ga0466706_250163 | 3300042599 | Bacteria | 1762 |
| 36 | Ga0466700_112177 | 3300042600 | Bacteria | 6478 |
| 37 | Ga0466722_074619 | 3300042609 | Bacteria | 1979 |
| 38 | Ga0466698_309777 | 3300042610 | Bacteria | 1541 |
| 39 | Ga0466693_154668 | 3300042592 | Bacteria | 13103 |
| 40 | Ga0466691_037826 | 3300042593 | Bacteria | 5317 |
| 41 | Ga0123355_10149373 | 3300009826 | Bacteria | 3554 |
| 42 | Ga0466703_233915 | 3300042636 | Bacteria | 9924 |
| 43 | Ga0466704_381979 | 3300042643 | Bacteria | 10325 |
| 44 | Ga0466709_321288 | 3300042648 | Bacteria | 1911 |
| 45 | Ga0466708_184157 | 3300042652 | Bacteria | 1982 |
| 46 | Ga0466705_521265 | 3300042612 | Bacteria | 3564 |
| 47 | Ga0466711_020557 | 3300042615 | Bacteria | 3394 |
| 48 | Ga0466718_049563 | 3300042617 | Bacteria | 29849 |
| 49 | Ga0466718_082129 | 3300042617 | Bacteria | 2141 |
| 50 | Ga0466723_041176 | 3300042618 | Bacteria | 11013 |
| 51 | Ga0466726_202470 | 3300042619 | Bacteria | 4962 |
| 52 | JGI24695J34938_10010169 | 3300002450 | Bacteria | 5179 |
| 53 | JGI24695J34938_10026540 | 3300002450 | Bacteria | 2751 |
| 54 | Ga0466706_076571 | 3300042599 | Bacteria | 1596 |
| 55 | Ga0466722_034476 | 3300042609 | Bacteria | 2836 |
| 56 | Ga0466698_058649 | 3300042610 | Bacteria | 1141 |
| 57 | Ga0466657_244110 | 3300042582 | Bacteria | 105773 |
| 58 | Ga0123356_10441202 | 3300010049 | Bacteria | 1448 |
| 59 | Ga0123356_10692653 | 3300010049 | Bacteria | 1188 |
| 60 | Ga0123356_10722207 | 3300010049 | Bacteria | 1166 |
| 61 | Ga0123356_11004114 | 3300010049 | Bacteria | 1004 |
| 62 | Ga0123356_11275919 | 3300010049 | Bacteria | 898 |
| 63 | Ga0123353_11524404 | 3300010167 | Bacteria | 850 |
| 64 | Ga0123353_12413853 | 3300010167 | Bacteria | 628 |
| 65 | Ga0466704_088671 | 3300042643 | Bacteria | 8929 |
| 66 | Ga0466709_266302 | 3300042648 | Bacteria | 7055 |
| 67 | Ga0466715_234140 | 3300042616 | Bacteria | 25168 |
| 68 | Ga0466715_413689 | 3300042616 | Bacteria | 1144 |
| 69 | Ga0466723_163959 | 3300042618 | Bacteria | 6684 |
| 70 | Ga0466723_168112 | 3300042618 | Bacteria | 13051 |
| 71 | Ga0466726_112415 | 3300042619 | Bacteria | 5892 |
| 72 | Ga0466726_488789 | 3300042619 | Bacteria | 1303 |
| 73 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 74 | JGI24695J34938_10003032 | 3300002450 | Bacteria | 12050 |
| 75 | Ga0466705_047043 | 3300042612 | Bacteria | 38569 |
| 76 | Ga0466733_182743 | 3300042659 | Bacteria | 4179 |
| 77 | Ga0466719_028469 | 3300042606 | Bacteria | 32780 |
| 78 | Ga0466719_543327 | 3300042606 | Bacteria | 1196 |
| 79 | Ga0456237_0000227 | 3300041968 | Bacteria | 8220 |
| 80 | Ga0466692_142857 | 3300042591 | Bacteria | 19089 |
| 81 | Ga0123356_10014421 | 3300010049 | Bacteria | 7599 |
| 82 | Ga0123356_10216293 | 3300010049 | Bacteria | 1969 |
| 83 | Ga0123353_10762091 | 3300010167 | Bacteria | 1345 |
| 84 | Ga0123353_11098506 | 3300010167 | Bacteria | 1056 |
| 85 | Ga0123353_11189327 | 3300010167 | Bacteria | 1002 |
| 86 | Ga0466704_029582 | 3300042643 | Bacteria | 40583 |
| 87 | Ga0466708_029443 | 3300042652 | Bacteria | 7255 |
| 88 | Ga0466708_075900 | 3300042652 | Bacteria | 6109 |
| 89 | Ga0466708_273124 | 3300042652 | Bacteria | 6278 |
| 90 | Ga0466728_160726 | 3300042620 | Bacteria | 1995 |
| 91 | AustNasuHG_c1025241 | 3300000089 | Bacteria | 1869 |
| 92 | JGI24695J34938_10002328 | 3300002450 | Bacteria | 14630 |
| 93 | JGI24695J34938_10106384 | 3300002450 | Bacteria | 1144 |
| 94 | Ga0072940_1055259 | 3300005200 | Bacteria | 1732 |
| 95 | Ga0466706_176360 | 3300042599 | Bacteria | 1666 |
| 96 | Ga0466706_204372 | 3300042599 | Bacteria | 1766 |
| 97 | Ga0466719_045712 | 3300042606 | Bacteria | 2007 |
| 98 | Ga0466722_039139 | 3300042609 | Bacteria | 12588 |
| 99 | Ga0466722_085585 | 3300042609 | Bacteria | 7945 |
| 100 | Ga0466692_042863 | 3300042591 | Unclassified | 1893 |
| 101 | Ga0466693_375094 | 3300042592 | Bacteria | 22157 |
| 102 | Ga0466696_085777 | 3300042596 | Bacteria | 3560 |
| 103 | Ga0123355_10432076 | 3300009826 | Bacteria | 1674 |
| 104 | Ga0123356_10005065 | 3300010049 | Bacteria | 13506 |
| 105 | Ga0123356_11157949 | 3300010049 | Bacteria | 940 |
| 106 | Ga0466735_009372 | 3300042624 | Bacteria | 2995 |
| 107 | Ga0466703_097458 | 3300042636 | Bacteria | 17144 |
| 108 | Ga0466727_301037 | 3300042655 | Bacteria | 2137 |
| 109 | Ga0466715_040894 | 3300042616 | Bacteria | 2074 |
| 110 | Ga0466715_466180 | 3300042616 | Bacteria | 1200 |
| 111 | Ga0466728_110252 | 3300042620 | Bacteria | 12059 |
| 112 | JGI24695J34938_10025535 | 3300002450 | Bacteria | 2823 |
| 113 | JGI24695J34938_10032759 | 3300002450 | Bacteria | 2398 |
| 114 | JGI24702J35022_10242375 | 3300002462 | Bacteria | 1046 |
| 115 | Ga0466705_176401 | 3300042612 | Bacteria | 3142 |
| 116 | Ga0466716_293854 | 3300042605 | Bacteria | 8099 |
| 117 | Ga0466719_111571 | 3300042606 | Bacteria | 1876 |
| 118 | Ga0466719_181684 | 3300042606 | Bacteria | 21794 |
| 119 | Ga0466691_012248 | 3300042593 | Bacteria | 11427 |
| 120 | Ga0466696_176668 | 3300042596 | Bacteria | 2611 |
| 121 | Ga0123353_10269897 | 3300010167 | Bacteria | 2622 |
| 122 | Ga0466734_025694 | 3300042623 | Bacteria | 2051 |
| 123 | Ga0466702_398370 | 3300042635 | Bacteria | 1917 |
| 124 | Ga0466708_007803 | 3300042652 | Bacteria | 12948 |
| 125 | Ga0466708_012255 | 3300042652 | Bacteria | 4318 |
| 126 | Ga0466708_354579 | 3300042652 | Bacteria | 12338 |
| 127 | Ga0466727_247314 | 3300042655 | Bacteria | 1383 |
| 128 | Ga0466728_365193 | 3300042620 | Bacteria | 9580 |
| 129 | JGI24695J34938_10002276 | 3300002450 | Bacteria | 14821 |
| 130 | Ga0068302_10418167 | 3300005071 | Bacteria | 2589 |
| 131 | Ga0466705_016129 | 3300042612 | Bacteria | 11821 |
| 132 | Ga0466705_027320 | 3300042612 | Bacteria | 6282 |
| 133 | Ga0415639_094088 | 3300038395 | Bacteria | 3918 |
| 134 | Ga0466690_340623 | 3300042590 | Bacteria | 1758 |
| 135 | Ga0466693_218717 | 3300042592 | Bacteria | 1270 |
| 136 | Ga0466691_073617 | 3300042593 | Bacteria | 4693 |
| 137 | Ga0123356_11093264 | 3300010049 | Bacteria | 966 |
| 138 | Ga0123353_10698284 | 3300010167 | Bacteria | 1425 |
| 139 | Ga0466704_147023 | 3300042643 | Bacteria | 8939 |
| 140 | Ga0466724_22399 | 3300042649 | Bacteria | 1203 |
| 141 | Ga0466711_099015 | 3300042615 | Bacteria | 17568 |
| 142 | Ga0466715_364588 | 3300042616 | Bacteria | 3866 |
| 143 | Ga0466728_140667 | 3300042620 | Bacteria | 2757 |
| 144 | JGI24695J34938_10016187 | 3300002450 | Bacteria | 3803 |
| 145 | JGI24695J34938_10016627 | 3300002450 | Bacteria | 3735 |
| 146 | JGI24695J34938_10063613 | 3300002450 | Bacteria | 1563 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00364 | Biotin_lipoyl | Biotin-requiring enzyme | 98 | 170 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.