Protein Family IF02696
Metagenome
Metatranscriptome
Isolate
324
Members
123
Samples
266
Scaffolds
197.22
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10011249|Ga0123356_100112493
- Length
- 232 aa
- Sequence
- MLLTLPYLSIAIRYLLFVEKDNFYKEPTTMVTNMVKNSNLVPMVIEQTNRGERSYDIYSRLLEDRIIFLTGEVNDITADLVIAQLLHLEGKDPDKDISLYINSPGGSVTAGMGIYDTMNYIKCDVSTICVGMAASMGAFLLAAGAKGKRYSLPNSEVMIHQPSGGSQGQASDIAIAAEHILKVKRRMNAILAKNCGQSVAKIEKDVDRDYYMTADEALEYGVIDKVFTRRA*
Sample Types
Isolate
17.9%
Metagenome
81.8%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
45.0%
Termitidae
26.7%
Kalotermitidae
10.8%
Formicidae
2.5%
Termopsidae
2.5%
Elmidae
2.5%
Passalidae
2.5%
Rhinotermitidae
1.7%
Culicidae
1.7%
Hodotermitidae
0.8%
Armadillidiidae
0.8%
Penaeidae
0.8%
Stratiomyidae
0.8%
Nephropidae
0.8%
Taxonomy
Archaea
0
Bacteria
300
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 2 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 3 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 4 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 5 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 6 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 7 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 8 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 9 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 20 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 35 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 36 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 37 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 38 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 39 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 40 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 47 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 48 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 51 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 52 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 53 | 2820396902 | Unclassified Firmicutes Nc150P1bin3 | Isolate | Unclassified |
| 54 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 55 | 2820449349 | Unclassified Firmicutes Lab288P3bin191 | Isolate | Unclassified |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 61 | 2820485985 | Unclassified Firmicutes Lab288P1bin73 | Isolate | Unclassified |
| 62 | 2820506701 | Unclassified Firmicutes Lab288P1bin46 | Isolate | Unclassified |
| 63 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 64 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 65 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 66 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 67 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 71 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 72 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 73 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 76 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 77 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 78 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 79 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 80 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 81 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 82 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 83 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 84 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 85 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 86 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 87 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 88 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 89 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 90 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 91 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 92 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 93 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 96 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 97 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 98 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 99 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 100 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 101 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 102 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 103 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 104 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 105 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 106 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 107 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 108 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 109 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 110 | 2820549969 | Unclassified Firmicutes Emb289P4bin66 | Isolate | Unclassified |
| 111 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 112 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 113 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 114 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 115 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 116 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 117 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 118 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 119 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 120 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 121 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 122 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 123 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_094463 | 3300042612 | Bacteria | 2823 |
| 2 | Ga0466705_313699 | 3300042612 | Bacteria | 3027 |
| 3 | Ga0466711_369345 | 3300042615 | Bacteria | 1684 |
| 4 | Ga0123355_10000465 | 3300009826 | Bacteria | 53509 |
| 5 | Ga0123355_10005638 | 3300009826 | Bacteria | 18378 |
| 6 | Ga0123355_10071448 | 3300009826 | Bacteria | 5571 |
| 7 | Ga0123356_10002798 | 3300010049 | Bacteria | 18496 |
| 8 | Ga0123356_10134926 | 3300010049 | Bacteria | 2424 |
| 9 | Ga0123356_10361389 | 3300010049 | Bacteria | 1579 |
| 10 | Ga0123353_10022194 | 3300010167 | Bacteria | 9559 |
| 11 | Ga0123353_10028297 | 3300010167 | Bacteria | 8608 |
| 12 | Ga0123353_10040013 | 3300010167 | Bacteria | 7389 |
| 13 | Ga0123353_10045568 | 3300010167 | Bacteria | 6960 |
| 14 | Ga0255809_1089983 | 3300022820 | Bacteria | 718 |
| 15 | Ga0264413_107316 | 3300024493 | Bacteria | 14607 |
| 16 | Ga0415639_028823 | 3300038395 | Bacteria | 4631 |
| 17 | 2227316637 | 2225789004 | Bacteria | 1196 |
| 18 | IMNBL1DRAFT_c0003186 | 3300000062 | Bacteria | 10742 |
| 19 | JGI24698J34947_10094208 | 3300002449 | Bacteria | 1365 |
| 20 | JGI24702J35022_10022275 | 3300002462 | Bacteria | 3431 |
| 21 | Ga0072940_1110518 | 3300005200 | Bacteria | 3800 |
| 22 | Ga0466701_037586 | 3300042598 | Bacteria | 1504 |
| 23 | Ga0466706_001611 | 3300042599 | Bacteria | 2248 |
| 24 | Ga0466707_243724 | 3300042601 | Bacteria | 73222 |
| 25 | Ga0466714_024006 | 3300042603 | Bacteria | 24403 |
| 26 | Ga0466721_104523 | 3300042608 | Unclassified | 1120 |
| 27 | Ga0466721_231963 | 3300042608 | Bacteria | 72994 |
| 28 | Ga0466703_349291 | 3300042636 | Bacteria | 5983 |
| 29 | Ga0466733_100002 | 3300042659 | Bacteria | 1084 |
| 30 | Ga0466728_075300 | 3300042620 | Bacteria | 48076 |
| 31 | Ga0123355_10506899 | 3300009826 | Bacteria | 1485 |
| 32 | Ga0123355_11070074 | 3300009826 | Bacteria | 844 |
| 33 | Ga0123355_11249593 | 3300009826 | Bacteria | 752 |
| 34 | Ga0123356_10203776 | 3300010049 | Bacteria | 2020 |
| 35 | Ga0123356_10443785 | 3300010049 | Bacteria | 1444 |
| 36 | Ga0123356_10842130 | 3300010049 | Bacteria | 1088 |
| 37 | Ga0123356_11537367 | 3300010049 | Bacteria | 822 |
| 38 | Ga0123353_10011489 | 3300010167 | Bacteria | 12481 |
| 39 | Ga0123353_10036732 | 3300010167 | Bacteria | 7677 |
| 40 | Ga0123353_10262497 | 3300010167 | Unclassified | 2666 |
| 41 | Ga0123353_10449932 | 3300010167 | Unclassified | 1896 |
| 42 | Ga0123353_10454874 | 3300010167 | Bacteria | 1883 |
| 43 | Ga0123354_10129966 | 3300010882 | Bacteria | 3187 |
| 44 | Ga0160467_100078 | 3300012829 | Bacteria | 146353 |
| 45 | Ga0466691_139149 | 3300042593 | Bacteria | 19243 |
| 46 | JGI24703J35330_11748718 | 3300002501 | Unclassified | 28726 |
| 47 | JGI24696J40584_12957611 | 3300002834 | Bacteria | 3603 |
| 48 | Ga0068305_10083217 | 3300005083 | Bacteria | 13496 |
| 49 | Ga0466714_036099 | 3300042603 | Bacteria | 6764 |
| 50 | Ga0466721_054780 | 3300042608 | Bacteria | 40923 |
| 51 | Ga0466730_087776 | 3300042625 | Bacteria | 1427 |
| 52 | Ga0466703_023298 | 3300042636 | Bacteria | 6358 |
| 53 | Ga0466704_129405 | 3300042643 | Bacteria | 91306 |
| 54 | Ga0466709_135344 | 3300042648 | Bacteria | 76409 |
| 55 | Ga0466727_131166 | 3300042655 | Bacteria | 1125 |
| 56 | Ga0466705_366447 | 3300042612 | Bacteria | 9583 |
| 57 | Ga0466711_029777 | 3300042615 | Bacteria | 4233 |
| 58 | Ga0466711_425353 | 3300042615 | Bacteria | 25651 |
| 59 | Ga0123357_10061680 | 3300009784 | Bacteria | 5024 |
| 60 | Ga0123357_10368190 | 3300009784 | Bacteria | 1351 |
| 61 | Ga0123355_10000329 | 3300009826 | Bacteria | 61283 |
| 62 | Ga0123356_10000057 | 3300010049 | Bacteria | 118961 |
| 63 | Ga0123356_10007433 | 3300010049 | Unclassified | 10932 |
| 64 | Ga0123356_10044570 | 3300010049 | Bacteria | 4129 |
| 65 | Ga0123356_10228168 | 3300010049 | Unclassified | 1924 |
| 66 | Ga0123356_10312620 | 3300010049 | Bacteria | 1681 |
| 67 | Ga0123356_10402811 | 3300010049 | Bacteria | 1506 |
| 68 | Ga0123356_10644261 | 3300010049 | Bacteria | 1226 |
| 69 | Ga0123356_11617073 | 3300010049 | Bacteria | 802 |
| 70 | Ga0123353_10006547 | 3300010167 | Bacteria | 15527 |
| 71 | Ga0123353_11038585 | 3300010167 | Bacteria | 1096 |
| 72 | Ga0123353_11741550 | 3300010167 | Bacteria | 778 |
| 73 | Ga0415639_140978 | 3300038395 | Unclassified | 2649 |
| 74 | Ga0415639_153927 | 3300038395 | Unclassified | 2478 |
| 75 | Ga0466690_350248 | 3300042590 | Bacteria | 5488 |
| 76 | Ga0466693_059160 | 3300042592 | Bacteria | 1929 |
| 77 | Ga0466696_466619 | 3300042596 | Bacteria | 2478 |
| 78 | 2227619059 | 2225789004 | Bacteria | 44942 |
| 79 | AustNasuHG_c1000026 | 3300000089 | Bacteria | 34289 |
| 80 | Ga0072941_1306275 | 3300005201 | Bacteria | 785 |
| 81 | Ga0466714_017714 | 3300042603 | Bacteria | 1860 |
| 82 | Ga0466714_159112 | 3300042603 | Bacteria | 4556 |
| 83 | Ga0466719_041719 | 3300042606 | Bacteria | 5663 |
| 84 | Ga0466719_200409 | 3300042606 | Bacteria | 1616 |
| 85 | Ga0466721_126879 | 3300042608 | Bacteria | 3177 |
| 86 | Ga0466722_183682 | 3300042609 | Bacteria | 7720 |
| 87 | Ga0466702_290872 | 3300042635 | Bacteria | 1862 |
| 88 | Ga0466703_008786 | 3300042636 | Bacteria | 3173 |
| 89 | Ga0466705_377400 | 3300042612 | Bacteria | 3437 |
| 90 | Ga0466732_076125 | 3300042656 | Bacteria | 1598 |
| 91 | Ga0466705_508102 | 3300042612 | Bacteria | 12902 |
| 92 | Ga0466726_125598 | 3300042619 | Bacteria | 1593 |
| 93 | Ga0123357_10101702 | 3300009784 | Bacteria | 3703 |
| 94 | Ga0123355_10000567 | 3300009826 | Bacteria | 49765 |
| 95 | Ga0123355_10012153 | 3300009826 | Bacteria | 13325 |
| 96 | Ga0123355_10104676 | 3300009826 | Bacteria | 4443 |
| 97 | Ga0123356_10002148 | 3300010049 | Bacteria | 21246 |
| 98 | Ga0123356_10002960 | 3300010049 | Bacteria | 17946 |
| 99 | Ga0123356_10011249 | 3300010049 | Bacteria | 8733 |
| 100 | Ga0123356_10017258 | 3300010049 | Bacteria | 6870 |
| 101 | Ga0123356_10027598 | 3300010049 | Unclassified | 5319 |
| 102 | Ga0123356_10084567 | 3300010049 | Bacteria | 3007 |
| 103 | Ga0123356_10115104 | 3300010049 | Unclassified | 2605 |
| 104 | Ga0123353_10186017 | 3300010167 | Bacteria | 3285 |
| 105 | Ga0123353_10230001 | 3300010167 | Bacteria | 2892 |
| 106 | Ga0123353_10682199 | 3300010167 | Bacteria | 1446 |
| 107 | Ga0123354_10098564 | 3300010882 | Bacteria | 3973 |
| 108 | Ga0123354_10177071 | 3300010882 | Unclassified | 2452 |
| 109 | Ga0160447_109453 | 3300012849 | Bacteria | 2235 |
| 110 | Ga0466690_200618 | 3300042590 | Bacteria | 51383 |
| 111 | Ga0466696_400141 | 3300042596 | Bacteria | 4336 |
| 112 | IMNBL1DRAFT_c0012182 | 3300000062 | Bacteria | 3952 |
| 113 | JGI24695J34938_10003810 | 3300002450 | Bacteria | 10253 |
| 114 | Ga0068305_10348210 | 3300005083 | Bacteria | 777 |
| 115 | Ga0102734_1001695 | 3300007129 | Bacteria | 5400 |
| 116 | Ga0103268_1000300 | 3300007192 | Unclassified | 16015 |
| 117 | Ga0466707_262676 | 3300042601 | Bacteria | 90434 |
| 118 | Ga0466707_354410 | 3300042601 | Bacteria | 6890 |
| 119 | Ga0466714_018261 | 3300042603 | Bacteria | 19225 |
| 120 | Ga0466714_156029 | 3300042603 | Bacteria | 3149 |
| 121 | Ga0466735_023383 | 3300042624 | Bacteria | 1424 |
| 122 | Ga0466702_047017 | 3300042635 | Bacteria | 1401 |
| 123 | Ga0466708_076369 | 3300042652 | Bacteria | 7494 |
| 124 | Ga0466705_128064 | 3300042612 | Bacteria | 302359 |
| 125 | Ga0466733_166837 | 3300042659 | Bacteria | 1264 |
| 126 | Ga0466718_032346 | 3300042617 | Bacteria | 2069 |
| 127 | Ga0466728_228948 | 3300042620 | Bacteria | 18179 |
| 128 | Ga0123355_10002265 | 3300009826 | Bacteria | 27148 |
| 129 | Ga0123355_10063176 | 3300009826 | Bacteria | 5972 |
| 130 | Ga0123355_10156226 | 3300009826 | Unclassified | 3450 |
| 131 | Ga0123355_10305246 | 3300009826 | Bacteria | 2164 |
| 132 | Ga0123355_10503189 | 3300009826 | Bacteria | 1493 |
| 133 | Ga0123356_10020549 | 3300010049 | Bacteria | 6245 |
| 134 | Ga0123356_10020684 | 3300010049 | Bacteria | 6223 |
| 135 | Ga0123356_10045857 | 3300010049 | Bacteria | 4067 |
| 136 | Ga0123356_10100780 | 3300010049 | Bacteria | 2770 |
| 137 | Ga0123356_10157045 | 3300010049 | Bacteria | 2267 |
| 138 | Ga0123356_10180619 | 3300010049 | Bacteria | 2131 |
| 139 | Ga0123353_10081251 | 3300010167 | Bacteria | 5211 |
| 140 | Ga0123353_10184803 | 3300010167 | Bacteria | 3297 |
| 141 | Ga0123353_10370178 | 3300010167 | Unclassified | 2149 |
| 142 | Ga0415639_004806 | 3300038395 | Bacteria | 37095 |
| 143 | Ga0415639_034085 | 3300038395 | Bacteria | 14578 |
| 144 | Ga0415639_038754 | 3300038395 | Unclassified | 3778 |
| 145 | Ga0466694_056009 | 3300042594 | Bacteria | 47779 |
| 146 | 2227384707 | 2225789004 | Unclassified | 1094 |
| 147 | 2227396931 | 2225789004 | Unclassified | 1078 |
| 148 | 2227480207 | 2225789004 | Bacteria | 22059 |
| 149 | JGI24702J35022_10001808 | 3300002462 | Bacteria | 13169 |
| 150 | JGI24702J35022_10016532 | 3300002462 | Bacteria | 4042 |
| 151 | Ga0072940_1021376 | 3300005200 | Unclassified | 3694 |
| 152 | Ga0072940_1190377 | 3300005200 | Unclassified | 4221 |
| 153 | Ga0466706_262560 | 3300042599 | Bacteria | 56435 |
| 154 | Ga0466700_304657 | 3300042600 | Bacteria | 1565 |
| 155 | Ga0466717_161060 | 3300042604 | Bacteria | 2142 |
| 156 | Ga0466721_390182 | 3300042608 | Bacteria | 5795 |
| 157 | Ga0466722_063783 | 3300042609 | Bacteria | 23373 |
| 158 | Ga0466735_226458 | 3300042624 | Bacteria | 1030 |
| 159 | Ga0466702_331277 | 3300042635 | Bacteria | 2068 |
| 160 | Ga0466703_187894 | 3300042636 | Bacteria | 2359 |
| 161 | Ga0466715_624295 | 3300042616 | Bacteria | 59856 |
| 162 | Ga0466729_120253 | 3300042621 | Bacteria | 7558 |
| 163 | Ga0123357_10570226 | 3300009784 | Bacteria | 889 |
| 164 | Ga0123355_10003020 | 3300009826 | Bacteria | 23968 |
| 165 | Ga0123355_10177590 | 3300009826 | Bacteria | 3168 |
| 166 | Ga0123355_10371151 | 3300009826 | Bacteria | 1874 |
| 167 | Ga0123355_10385076 | 3300009826 | Bacteria | 1823 |
| 168 | Ga0123355_10389266 | 3300009826 | Bacteria | 1808 |
| 169 | Ga0123355_10642476 | 3300009826 | Bacteria | 1242 |
| 170 | Ga0123355_10904902 | 3300009826 | Bacteria | 958 |
| 171 | Ga0123356_10009132 | 3300010049 | Bacteria | 9807 |
| 172 | Ga0123356_10372860 | 3300010049 | Bacteria | 1558 |
| 173 | Ga0123356_10390301 | 3300010049 | Bacteria | 1527 |
| 174 | Ga0123353_10102637 | 3300010167 | Bacteria | 4610 |
| 175 | Ga0123353_10110222 | 3300010167 | Bacteria | 4434 |
| 176 | Ga0123353_10288968 | 3300010167 | Bacteria | 2511 |
| 177 | Ga0123353_10433292 | 3300010167 | Bacteria | 1943 |
| 178 | Ga0123353_10493049 | 3300010167 | Bacteria | 1788 |
| 179 | Ga0123353_10815987 | 3300010167 | Bacteria | 1285 |
| 180 | Ga0466696_234586 | 3300042596 | Bacteria | 14199 |
| 181 | Ga0103264_1000362 | 3300007188 | Bacteria | 24061 |
| 182 | Ga0466713_089196 | 3300042602 | Bacteria | 75262 |
| 183 | Ga0466717_282788 | 3300042604 | Bacteria | 2496 |
| 184 | Ga0466721_146479 | 3300042608 | Bacteria | 28178 |
| 185 | Ga0466722_218002 | 3300042609 | Bacteria | 2362 |
| 186 | Ga0466702_249567 | 3300042635 | Bacteria | 56707 |
| 187 | Ga0466705_223551 | 3300042612 | Bacteria | 7668 |
| 188 | Ga0466705_297351 | 3300042612 | Bacteria | 46878 |
| 189 | Ga0466732_065742 | 3300042656 | Bacteria | 5638 |
| 190 | Ga0466733_056369 | 3300042659 | Bacteria | 1523 |
| 191 | Ga0466705_410534 | 3300042612 | Bacteria | 1063 |
| 192 | Ga0466718_044022 | 3300042617 | Bacteria | 8348 |
| 193 | Ga0466718_103822 | 3300042617 | Bacteria | 23120 |
| 194 | Ga0466726_321478 | 3300042619 | Bacteria | 3004 |
| 195 | Ga0123357_10468475 | 3300009784 | Bacteria | 1076 |
| 196 | Ga0123355_10489962 | 3300009826 | Bacteria | 1523 |
| 197 | Ga0123355_10918810 | 3300009826 | Bacteria | 947 |
| 198 | Ga0123355_11257145 | 3300009826 | Bacteria | 748 |
| 199 | Ga0123355_11290471 | 3300009826 | Unclassified | 734 |
| 200 | Ga0123356_10000734 | 3300010049 | Bacteria | 36122 |
| 201 | Ga0123356_10231996 | 3300010049 | Bacteria | 1910 |
| 202 | Ga0123356_10264844 | 3300010049 | Bacteria | 1805 |
| 203 | Ga0123356_10266521 | 3300010049 | Bacteria | 1800 |
| 204 | Ga0123353_10003722 | 3300010167 | Bacteria | 19394 |
| 205 | Ga0123353_11856958 | 3300010167 | Bacteria | 746 |
| 206 | Ga0160471_102761 | 3300012812 | Bacteria | 2820 |
| 207 | Ga0160453_100037 | 3300012814 | Bacteria | 166272 |
| 208 | Ga0415639_007993 | 3300038395 | Bacteria | 13540 |
| 209 | Ga0415639_012419 | 3300038395 | Unclassified | 16758 |
| 210 | Ga0415639_031238 | 3300038395 | Unclassified | 2102 |
| 211 | Ga0415639_056611 | 3300038395 | Bacteria | 2983 |
| 212 | Ga0466690_400237 | 3300042590 | Bacteria | 1921 |
| 213 | Ga0466699_437541 | 3300042597 | Bacteria | 2885 |
| 214 | IMNBL1DRAFT_c0003846 | 3300000062 | Bacteria | 9344 |
| 215 | IMNBL1DRAFT_c0008061 | 3300000062 | Unclassified | 5420 |
| 216 | JGI24702J35022_10000014 | 3300002462 | Bacteria | 67881 |
| 217 | JGI24703J35330_11748402 | 3300002501 | Bacteria | 15442 |
| 218 | Ga0466706_003990 | 3300042599 | Bacteria | 92154 |
| 219 | Ga0466707_066253 | 3300042601 | Bacteria | 1596 |
| 220 | Ga0466707_163801 | 3300042601 | Bacteria | 828024 |
| 221 | Ga0466714_006313 | 3300042603 | Bacteria | 4873 |
| 222 | Ga0466719_293079 | 3300042606 | Bacteria | 4035 |
| 223 | Ga0466722_009994 | 3300042609 | Bacteria | 36442 |
| 224 | Ga0466698_245644 | 3300042610 | Unclassified | 1307 |
| 225 | Ga0466731_057416 | 3300042622 | Bacteria | 52082 |
| 226 | Ga0466734_090787 | 3300042623 | Bacteria | 1057 |
| 227 | Ga0466702_123396 | 3300042635 | Bacteria | 2911 |
| 228 | Ga0466702_232398 | 3300042635 | Bacteria | 3760 |
| 229 | Ga0466705_106827 | 3300042612 | Bacteria | 52611 |
| 230 | Ga0466732_240288 | 3300042656 | Bacteria | 1289 |
| 231 | Ga0466723_087573 | 3300042618 | Bacteria | 3154 |
| 232 | Ga0123355_10001419 | 3300009826 | Bacteria | 33460 |
| 233 | Ga0123355_10051478 | 3300009826 | Bacteria | 6683 |
| 234 | Ga0123355_10290820 | 3300009826 | Bacteria | 2242 |
| 235 | Ga0123355_10303842 | 3300009826 | Bacteria | 2171 |
| 236 | Ga0123355_10366222 | 3300009826 | Bacteria | 1893 |
| 237 | Ga0123355_10529929 | 3300009826 | Bacteria | 1436 |
| 238 | Ga0123355_10582875 | 3300009826 | Bacteria | 1336 |
| 239 | Ga0123356_10000105 | 3300010049 | Bacteria | 88897 |
| 240 | Ga0123356_10012518 | 3300010049 | Bacteria | 8226 |
| 241 | Ga0123356_10125900 | 3300010049 | Bacteria | 2501 |
| 242 | Ga0123356_10157858 | 3300010049 | Bacteria | 2261 |
| 243 | Ga0123356_10173735 | 3300010049 | Bacteria | 2168 |
| 244 | Ga0123356_10273135 | 3300010049 | Bacteria | 1781 |
| 245 | Ga0123353_10009342 | 3300010167 | Bacteria | 13516 |
| 246 | Ga0123353_10170581 | 3300010167 | Bacteria | 3454 |
| 247 | Ga0123353_10337230 | 3300010167 | Bacteria | 2279 |
| 248 | Ga0123353_10379837 | 3300010167 | Bacteria | 2113 |
| 249 | Ga0123353_10639292 | 3300010167 | Bacteria | 1509 |
| 250 | Ga0123353_10818197 | 3300010167 | Bacteria | 1283 |
| 251 | Ga0123353_11884290 | 3300010167 | Bacteria | 738 |
| 252 | Ga0466691_069588 | 3300042593 | Bacteria | 6074 |
| 253 | Ga0466696_246837 | 3300042596 | Bacteria | 15758 |
| 254 | 2226995104 | 2225789003 | Bacteria | 1458 |
| 255 | 2227473974 | 2225789004 | Bacteria | 901 |
| 256 | 2227619060 | 2225789004 | Bacteria | 44860 |
| 257 | IMNBL1DRAFT_c0008674 | 3300000062 | Bacteria | 5145 |
| 258 | JGI24695J34938_10013983 | 3300002450 | Bacteria | 4187 |
| 259 | Ga0068305_10007452 | 3300005083 | Bacteria | 13371 |
| 260 | Ga0466717_160927 | 3300042604 | Bacteria | 3625 |
| 261 | Ga0466721_255386 | 3300042608 | Bacteria | 1081 |
| 262 | Ga0466702_264646 | 3300042635 | Bacteria | 26891 |
| 263 | Ga0466703_158769 | 3300042636 | Bacteria | 45129 |
| 264 | Ga0466704_051166 | 3300042643 | Bacteria | 6746 |
| 265 | Ga0466709_247116 | 3300042648 | Bacteria | 53881 |
| 266 | Ga0466725_129370 | 3300042654 | Bacteria | 3042 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00574 | CLP_protease | Clp protease | 50 | 229 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.