Protein Family IF02664

Metagenome Metatranscriptome Isolate
199 Members
132 Samples
113 Scaffolds
157.05 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10003991|Ga0123356_1000399112
Length
158 aa
Sequence
MSRRRNAEKREITPDPKFNSALVTQFINNVTKSGKKRLAENLFYSAVEMAGQRSGGVDGLSVFKKAVENVKPVLEVKSRRIGGANYQVPIEVPAERRVSLAIRWLISYAKQRSEKSMAEKLANEFVQASKNEGGAIRKKIDTHKMAEANKAFAHFRY*

📊 Sample Types

Isolate 43.2%
Metagenome 54.3%
MAG 0.0%
Metatranscriptome 2.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.3%
Termitidae 16.7%
Apidae 10.0%
Halictidae 7.5%
Kalotermitidae 7.5%
Tenebrionidae 5.8%
Blattidae 5.0%
Drosophilidae 3.3%
Scarabaeidae 2.5%
Formicidae 2.5%
Passalidae 2.5%
Elmidae 1.7%
Termopsidae 1.7%
Calliphoridae 0.8%
Vespidae 0.8%
Stratiomyidae 0.8%
Bombycidae 0.8%
Hodotermitidae 0.8%
Armadillidiidae 0.8%
Libellulidae 0.8%
Cerambycidae 0.8%
Rhinotermitidae 0.8%
Gomphidae 0.8%
Nephropidae 0.8%
Noctuidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 175
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
3 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
4 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
5 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
6 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
7 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
8 2595698193 Melissococcus plutonius B5 Isolate Apidae
9 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
10 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
11 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
12 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
13 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
14 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
15 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
16 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
17 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
18 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
27 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
28 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
29 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
30 2864895409 Bacillus aerius S00152 Isolate Elmidae
31 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
32 2595698197 Melissococcus plutonius H6 Isolate Apidae
33 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
34 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
35 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
36 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
37 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
38 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
39 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
40 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
46 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
47 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
48 2595698195 Melissococcus plutonius 119 Isolate Apidae
49 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
50 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
51 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
52 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
53 8007223943 Enterococcus sp. MSG2901 Isolate
54 8012112996 Staphylococcus muscae ATCC 49910 Isolate
55 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
56 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
57 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
58 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
62 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
63 8112490586 Staphylococcus muscae CCM 4175 Isolate
64 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
65 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
66 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
67 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
68 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
69 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
70 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
71 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
72 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
73 2820634724 Unclassified Firmicutes Emb289P1bin116 Isolate Unclassified
74 8108568626 Enterococcus sp. DIV1094 Isolate
75 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
76 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
77 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
78 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
79 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
80 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
81 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
82 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
83 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
84 2595698199 Melissococcus plutonius 60 Isolate Apidae
85 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
86 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
87 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
88 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
89 8007237282 Enterococcus sp. DIV0212c Isolate
90 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
91 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
92 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
93 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
94 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
95 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
96 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
97 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
98 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
99 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
100 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
101 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
102 2595698198 Melissococcus plutonius L9 Isolate Apidae
103 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
104 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
105 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
106 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
107 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
108 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
109 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
110 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
111 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
112 8114555646 Enterococcus sp. DIV1094 Isolate
113 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
114 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
115 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
116 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
117 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
118 2627853628 Melissococcus plutonius 82 Isolate Apidae
119 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
120 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
121 2864801025 Bacillus aerius S00042 Isolate Elmidae
122 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
123 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
124 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
125 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
126 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
127 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
128 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
129 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
130 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
131 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
132 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0011 3300056790 Bacteria 1623141
2 Ga0466711_488367 3300042615 Bacteria 14361
3 Ga0466707_250286 3300042601 Unclassified 2774
4 Ga0466707_266828 3300042601 Bacteria 1006
5 2227607975 2225789004 Unclassified 2285
6 JGI24697J35500_10899030 3300002507 Bacteria 807
7 Ga0072941_1103827 3300005201 Bacteria 2530
8 Ga0123355_10260693 3300009826 Bacteria 2424
9 Ga0123356_12003578 3300010049 Bacteria 722
10 Ga0123353_10521517 3300010167 Bacteria 1724
11 Ga0562378_0008 3300056814 Bacteria 1370151
12 Ga0466715_257161 3300042616 Bacteria 85931
13 Ga0466715_262608 3300042616 Bacteria 6632
14 Ga0466735_070611 3300042624 Unclassified 1325
15 AglaG_GDN60OX02IRH8P 2084038013 Unclassified 532
16 2227121641 2225789004 Unclassified 1699
17 Ga0160467_100322 3300012829 Bacteria 52269
18 Ga0255808_1004439 3300023282 Unclassified 2197
19 Ga0123357_10012257 3300009784 Bacteria 11047
20 Ga0123353_10433002 3300010167 Bacteria 1944
21 Ga0123353_11808333 3300010167 Bacteria 759
22 Ga0530661_000718 3300056564 Unclassified 21906
23 Ga0466715_481552 3300042616 Bacteria 17646
24 Ga0466719_239553 3300042606 Bacteria 9313
25 2227066264 2225789003 Unclassified 666
26 2227646819 2225789004 Bacteria 44364
27 IMNBL1DRAFT_c0000241 3300000062 Bacteria 48129
28 JGI24695J34938_10035309 3300002450 Bacteria 2287
29 Ga0466691_046649 3300042593 Bacteria 3408
30 Ga0123357_10284789 3300009784 Bacteria 1700
31 Ga0123355_10055693 3300009826 Bacteria 6402
32 Ga0123355_10225755 3300009826 Bacteria 2684
33 Ga0123356_12998972 3300010049 Bacteria 589
34 Ga0123353_10242518 3300010167 Bacteria 2799
35 Ga0123353_10270864 3300010167 Unclassified 2616
36 Ga0123353_10556619 3300010167 Bacteria 1652
37 Ga0123354_10301991 3300010882 Bacteria 1512
38 Ga0466705_377866 3300042612 Bacteria 2815
39 Ga0562379_0879 3300056790 Bacteria 44973
40 Ga0562379_2916 3300056790 Bacteria 12733
41 Ga0562377_0006 3300056842 Bacteria 3350072
42 Ga0562374_1307 3300057007 Bacteria 30195
43 Ga0466706_104819 3300042599 Unclassified 10684
44 Ga0466706_196526 3300042599 Bacteria 1233
45 Ga0466706_242096 3300042599 Bacteria 4062
46 Ga0466707_152663 3300042601 Bacteria 4882
47 Ga0466719_298555 3300042606 Bacteria 20171
48 2227601024 2225789004 Bacteria 2337
49 2227672131 2225789004 Unclassified 1892
50 IMNBL1DRAFT_c0173851 3300000062 Unclassified 546
51 JGI24703J35330_11748732 3300002501 Bacteria 29684
52 Ga0123355_10456500 3300009826 Bacteria 1607
53 Ga0123356_10278162 3300010049 Bacteria 1767
54 Ga0123353_11252621 3300010167 Bacteria 968
55 Ga0466706_158072 3300042599 Bacteria 12307
56 Ga0466704_327672 3300042643 Bacteria 29858
57 Ga0466709_028819 3300042648 Bacteria 2947
58 2226987898 2225789003 Unclassified 1667
59 2227513826 2225789004 Unclassified 3494
60 2227544084 2225789004 Bacteria 15356
61 2227649629 2225789004 Bacteria 10798
62 IMNBL1DRAFT_c0006609 3300000062 Bacteria 6291
63 IMNBL1DRAFT_c0016963 3300000062 Bacteria 3089
64 IMNBL1DRAFT_c0019087 3300000062 Bacteria 2822
65 AustNasuHG_c1011205 3300000089 Bacteria 3109
66 Ga0415639_014593 3300038395 Unclassified 5864
67 Ga0123355_10208781 3300009826 Unclassified 2835
68 Ga0123355_10221348 3300009826 Bacteria 2721
69 Ga0123355_10893794 3300009826 Bacteria 967
70 Ga0123356_10003991 3300010049 Bacteria 15330
71 Ga0562376_0063 3300056857 Bacteria 267702
72 Ga0466706_038772 3300042599 Bacteria 6236
73 Ga0466706_050734 3300042599 Bacteria 49644
74 Ga0466707_062300 3300042601 Bacteria 130663
75 Ga0466709_054276 3300042648 Unclassified 1488
76 2227247451 2225789004 Bacteria 32242
77 IMNBL1DRAFT_c0000268 3300000062 Bacteria 46090
78 IMNBL1DRAFT_c0010442 3300000062 Unclassified 4444
79 AustNasuHG_c1012310 3300000089 Unclassified 2953
80 Ga0233288_1005524 3300022232 Bacteria 1247
81 Ga0466690_196200 3300042590 Unclassified 2174
82 Ga0466726_355238 3300042619 Bacteria 13364
83 Ga0466707_168226 3300042601 Bacteria 11522
84 Ga0466714_034586 3300042603 Bacteria 3040
85 Ga0466716_469396 3300042605 Bacteria 9930
86 Ga0466730_089070 3300042625 Bacteria 1395
87 2227121916 2225789004 Unclassified 1698
88 2227356341 2225789004 Bacteria 1134
89 2227464709 2225789004 Bacteria 982
90 IMNBL1DRAFT_c0004716 3300000062 Bacteria 8070
91 IMNBL1DRAFT_c0015584 3300000062 Bacteria 3295
92 CVPL010L_1000065 3300002932 Unclassified 54722
93 Ga0222431_1026073 3300021190 Bacteria 1166
94 Ga0415639_174965 3300038395 Bacteria 3149
95 Ga0466693_179292 3300042592 Bacteria 4915
96 Ga0123355_10704972 3300009826 Bacteria 1157
97 Ga0123355_11829039 3300009826 Unclassified 571
98 Ga0466705_264536 3300042612 Bacteria 2358
99 Ga0466733_115687 3300042659 Bacteria 10819
100 Ga0466733_190676 3300042659 Bacteria 1547
101 Ga0562377_0317 3300056842 Bacteria 97339
102 Ga0466705_488388 3300042612 Bacteria 10904
103 Ga0466721_235909 3300042608 Bacteria 27576
104 Ga0466722_094775 3300042609 Bacteria 4300
105 IMNBL1DRAFT_c0000036 3300000062 Bacteria 120012
106 IMNBL1DRAFT_c0020533 3300000062 Bacteria 2672
107 IMNBL1DRAFT_c0032549 3300000062 Bacteria 1879
108 Ga0233288_1001098 3300022232 Bacteria 2097
109 Ga0255809_1020759 3300022820 Unclassified 1474
110 Ga0466693_097661 3300042592 Bacteria 2187
111 Ga0466693_404523 3300042592 Bacteria 3204
112 Ga0123357_10042851 3300009784 Bacteria 6152
113 Ga0123353_10295389 3300010167 Bacteria 2477

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e 2 150 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.