Protein Family IF02637
Metagenome
Metatranscriptome
Isolate
732
Members
254
Samples
544
Scaffolds
445.88
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10001123|Ga0123356_1000112315
- Length
- 493 aa
- Sequence
- MPRPVTQHVYSTIIRESGQTMLNFIFVADILICTFSEECSIFMEVFLMSERKIIIIGAAGRDFHNFNAFYRDNPAYRVVAFTAAQIPDIADRKYPASLAGDLYPDGIPIYEQNELEDLIKTLDADECVFSYSDVPYTYVMSLGAKVNAAGAAFTMLGHKDTMIKSTKPVVAVGSIRTGCGKSQTSRRIAEVLMAGGLKVIAIRHPMPYGDLEAQKVQRFATIEDLKKHKCTIEEMEEYEPHIERGNVIYAGVDYEAILRAAENDPDGCDVILWDGGNNDFPFYVPDLMVAVTDPHRPGHELSYYPGEVTLRLADVVVINKIDSADYKNILTVRESIERVNPTAVVVDAASTISVEKPELIRGKRVLIIEDGPTLTHGEMKIGAGVVAAKRFGAKEIIDPKPYAVGSLADTFRSYPHIENILPAMGYGEDQMRDLSETIARVDCDTVVIATPIDLGRVIDISKPNTRVEYSLQEIGHPDIEDVLRELIGKIKG*
Sample Types
Isolate
25.7%
Metagenome
74.2%
MAG
0.0%
Metatranscriptome
0.1%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
75.0%
Termitidae
15.9%
Kalotermitidae
5.6%
Termopsidae
1.6%
Rhinotermitidae
1.2%
Passalidae
0.8%
Taxonomy
Archaea
58
Bacteria
610
Eukaryota
0
Viruses
0
Unclassified
64
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2772190992 | Unclassified Bathyarchaeota Emb289P3bin80 | Isolate | Unclassified |
| 3 | 2772191001 | Unclassified Bathyarchaeota Th196P4bin19 | Isolate | Unclassified |
| 4 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 5 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 6 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 7 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 8 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 9 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 10 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 11 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 12 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 13 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 14 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 15 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 16 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 17 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 18 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 19 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 20 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 21 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 22 | 2820680340 | Unclassified Firmicutes Co191P1bin89 | Isolate | Unclassified |
| 23 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 24 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 25 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 26 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 38 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 39 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 40 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 41 | 2773857691 | Unclassified Methanomassiliicoccaceae Nt197P4bin4 | Isolate | Unclassified |
| 42 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 43 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 44 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 45 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 46 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 47 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 48 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 49 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 50 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 51 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 52 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 53 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 54 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 55 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 56 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 57 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 58 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 59 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 60 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 61 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 62 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 63 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 70 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 71 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 72 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 73 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 74 | 2772191000 | Unclassified Bathyarchaeota Nt197P4bin22 | Isolate | Unclassified |
| 75 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 76 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 77 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 78 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 79 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 80 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 81 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 82 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 83 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 84 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 85 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 86 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 87 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 88 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 89 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 90 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 91 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 92 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 93 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 94 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 95 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 96 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 97 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 98 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 99 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 100 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 101 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 102 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 103 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 104 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 105 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 106 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 107 | 2772190988 | Unclassified Bathyarchaeota Co191P1bin46 | Isolate | Unclassified |
| 108 | 2772190991 | Unclassified Bathyarchaeota Emb289P3bin109 | Isolate | Unclassified |
| 109 | 2772190996 | Unclassified Bathyarchaeota Lab288P4bin61 | Isolate | Unclassified |
| 110 | 2772190997 | Unclassified Bathyarchaeota Lab288P4bin25 | Isolate | Unclassified |
| 111 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 112 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 113 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 114 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 115 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 116 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 117 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 118 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 119 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 120 | 2820485985 | Unclassified Firmicutes Lab288P1bin73 | Isolate | Unclassified |
| 121 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 122 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 123 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 124 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 125 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 126 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 127 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 128 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 129 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 130 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 131 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 132 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 133 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 134 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 135 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 136 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 137 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 138 | 2772190976 | Unclassified Bathyarchaeota Co191P4bin18 | Isolate | Unclassified |
| 139 | 2772190990 | Unclassified Bathyarchaeota Emb289P1bin127 | Isolate | Unclassified |
| 140 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 141 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 142 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 143 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 144 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 145 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 146 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 147 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 148 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 149 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 150 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 151 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 152 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 153 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 154 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 155 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 156 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 157 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 158 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 159 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 160 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 161 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 162 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 163 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 164 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 165 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 166 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 167 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 168 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 169 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 170 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 171 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 172 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 173 | 2773857695 | Unclassified Methanosarcinaceae Th196P4bin37 | Isolate | Unclassified |
| 174 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 175 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 176 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 177 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 178 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 179 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 180 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 181 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 182 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 183 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 184 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 185 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 186 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 187 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 188 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 189 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 190 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 191 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 192 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 193 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 194 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 195 | 2772190994 | Unclassified Bathyarchaeota Lab288P3bin169 | Isolate | Unclassified |
| 196 | 2772190995 | Unclassified Bathyarchaeota Lab288P3bin115 | Isolate | Unclassified |
| 197 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 198 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 199 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 200 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 201 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 202 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 203 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 204 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 205 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 206 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 207 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 208 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 209 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 210 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 211 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 212 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 213 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 214 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 215 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 216 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 217 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 218 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 219 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 220 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 221 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 222 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 223 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 224 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 225 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 226 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 227 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 228 | 2772190974 | Unclassified Bathyarchaeota Co191P3bin4 | Isolate | Unclassified |
| 229 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 230 | 2773857679 | Unclassified Methanomassiliicoccaceae Cu122P4bin8 | Isolate | Unclassified |
| 231 | 2773857698 | Unclassified Methanomassiliicoccaceae Th196P4bin35 | Isolate | Unclassified |
| 232 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 233 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 234 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 235 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 236 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 237 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 238 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 239 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 240 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 241 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 242 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 243 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 244 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 245 | 2820544053 | Unclassified Firmicutes Lab288P1bin108 | Isolate | Unclassified |
| 246 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 247 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 248 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 249 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 250 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 251 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 252 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 253 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 254 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_098236 | 3300042611 | Bacteria | 2198 |
| 2 | Ga0466733_145729 | 3300042659 | Bacteria | 8091 |
| 3 | Ga0466705_474341 | 3300042612 | Bacteria | 80430 |
| 4 | Ga0466710_119444 | 3300042613 | Unclassified | 4494 |
| 5 | Ga0466710_234417 | 3300042613 | Unclassified | 1903 |
| 6 | Ga0466710_280408 | 3300042613 | Unclassified | 1547 |
| 7 | Ga0466712_092110 | 3300042614 | Bacteria | 7766 |
| 8 | Ga0466712_126293 | 3300042614 | Bacteria | 24000 |
| 9 | Ga0466712_151998 | 3300042614 | Bacteria | 1878 |
| 10 | Ga0466712_204416 | 3300042614 | Bacteria | 2210 |
| 11 | Ga0466711_050548 | 3300042615 | Bacteria | 13911 |
| 12 | Ga0466715_072498 | 3300042616 | Bacteria | 11998 |
| 13 | Ga0466700_022548 | 3300042600 | Bacteria | 2489 |
| 14 | Ga0466716_251109 | 3300042605 | Bacteria | 15660 |
| 15 | Ga0466721_185195 | 3300042608 | Bacteria | 10074 |
| 16 | Ga0466731_001749 | 3300042622 | Unclassified | 5223 |
| 17 | Ga0466731_225622 | 3300042622 | Bacteria | 36027 |
| 18 | Ga0466704_403765 | 3300042643 | Bacteria | 2185 |
| 19 | Ga0466709_246760 | 3300042648 | Bacteria | 12601 |
| 20 | Ga0466725_432935 | 3300042654 | Bacteria | 2462 |
| 21 | Ga0233288_1011036 | 3300022232 | Archaea | 1599 |
| 22 | Ga0415639_051860 | 3300038395 | Bacteria | 15923 |
| 23 | Ga0466657_130278 | 3300042582 | Archaea | 40721 |
| 24 | Ga0466690_120449 | 3300042590 | Bacteria | 3181 |
| 25 | Ga0466690_185521 | 3300042590 | Bacteria | 30034 |
| 26 | Ga0466693_234588 | 3300042592 | Unclassified | 22879 |
| 27 | Ga0466693_284844 | 3300042592 | Bacteria | 28082 |
| 28 | Ga0466694_159261 | 3300042594 | Bacteria | 5852 |
| 29 | Ga0466696_394659 | 3300042596 | Bacteria | 38057 |
| 30 | Ga0466696_455978 | 3300042596 | Bacteria | 2875 |
| 31 | Ga0123357_10024848 | 3300009784 | Bacteria | 8077 |
| 32 | Ga0123355_10000203 | 3300009826 | Bacteria | 74062 |
| 33 | Ga0123355_10000212 | 3300009826 | Bacteria | 72880 |
| 34 | Ga0123355_10001191 | 3300009826 | Bacteria | 36176 |
| 35 | Ga0123355_10001909 | 3300009826 | Bacteria | 29314 |
| 36 | Ga0123355_10002637 | 3300009826 | Bacteria | 25469 |
| 37 | Ga0123355_10003634 | 3300009826 | Bacteria | 22216 |
| 38 | Ga0123355_10007035 | 3300009826 | Bacteria | 16765 |
| 39 | Ga0123355_10008550 | 3300009826 | Bacteria | 15463 |
| 40 | Ga0123355_10023002 | 3300009826 | Bacteria | 10000 |
| 41 | Ga0123355_10050341 | 3300009826 | Bacteria | 6768 |
| 42 | Ga0123355_10053633 | 3300009826 | Bacteria | 6536 |
| 43 | Ga0123355_10072800 | 3300009826 | Bacteria | 5510 |
| 44 | Ga0123355_10074912 | 3300009826 | Unclassified | 5420 |
| 45 | Ga0123355_10081989 | 3300009826 | Unclassified | 5146 |
| 46 | Ga0123356_10000310 | 3300010049 | Bacteria | 55868 |
| 47 | Ga0123356_10002790 | 3300010049 | Bacteria | 18527 |
| 48 | Ga0123356_10006649 | 3300010049 | Bacteria | 11654 |
| 49 | Ga0123356_10009257 | 3300010049 | Bacteria | 9731 |
| 50 | Ga0123356_10018702 | 3300010049 | Bacteria | 6576 |
| 51 | Ga0123356_10039278 | 3300010049 | Bacteria | 4410 |
| 52 | Ga0123356_10095694 | 3300010049 | Archaea | 2839 |
| 53 | Ga0123356_10152277 | 3300010049 | Bacteria | 2298 |
| 54 | Ga0123356_10177761 | 3300010049 | Bacteria | 2147 |
| 55 | Ga0123353_10000146 | 3300010167 | Bacteria | 87435 |
| 56 | Ga0123353_10032220 | 3300010167 | Bacteria | 8137 |
| 57 | Ga0123353_10050447 | 3300010167 | Bacteria | 6634 |
| 58 | Ga0123353_10083979 | 3300010167 | Unclassified | 5126 |
| 59 | Ga0123353_10222628 | 3300010167 | Bacteria | 2949 |
| 60 | Ga0123353_10223631 | 3300010167 | Bacteria | 2941 |
| 61 | Ga0123353_10300541 | 3300010167 | Unclassified | 2450 |
| 62 | Ga0123353_10513937 | 3300010167 | Bacteria | 1740 |
| 63 | JGI24698J34947_10000403 | 3300002449 | Bacteria | 19691 |
| 64 | JGI24698J34947_10001552 | 3300002449 | Bacteria | 12154 |
| 65 | JGI24698J34947_10006970 | 3300002449 | Bacteria | 6211 |
| 66 | JGI24695J34938_10001313 | 3300002450 | Bacteria | 21661 |
| 67 | JGI24702J35022_10000061 | 3300002462 | Bacteria | 46184 |
| 68 | JGI24702J35022_10000438 | 3300002462 | Bacteria | 25142 |
| 69 | JGI24702J35022_10002616 | 3300002462 | Bacteria | 10929 |
| 70 | JGI24702J35022_10009771 | 3300002462 | Unclassified | 5381 |
| 71 | JGI24702J35022_10016125 | 3300002462 | Bacteria | 4102 |
| 72 | JGI24705J35276_12194416 | 3300002504 | Bacteria | 1511 |
| 73 | Ga0072941_1204710 | 3300005201 | Bacteria | 4774 |
| 74 | Ga0466697_091705 | 3300042611 | Bacteria | 6541 |
| 75 | Ga0466697_139962 | 3300042611 | Bacteria | 2582 |
| 76 | Ga0466710_033855 | 3300042613 | Unclassified | 5090 |
| 77 | Ga0466726_334274 | 3300042619 | Bacteria | 3163 |
| 78 | Ga0466701_057014 | 3300042598 | Bacteria | 8198 |
| 79 | Ga0466701_101828 | 3300042598 | Bacteria | 4092 |
| 80 | Ga0466700_308813 | 3300042600 | Archaea | 1567 |
| 81 | Ga0466719_518251 | 3300042606 | Bacteria | 13702 |
| 82 | Ga0466697_046400 | 3300042611 | Bacteria | 23784 |
| 83 | Ga0466731_023412 | 3300042622 | Archaea | 1663 |
| 84 | Ga0466703_295649 | 3300042636 | Bacteria | 12564 |
| 85 | Ga0466704_101324 | 3300042643 | Bacteria | 5850 |
| 86 | Ga0466704_171642 | 3300042643 | Unclassified | 8649 |
| 87 | Ga0466708_004442 | 3300042652 | Bacteria | 11050 |
| 88 | Ga0466725_224688 | 3300042654 | Bacteria | 4434 |
| 89 | Ga0415639_000008 | 3300038395 | Bacteria | 21299 |
| 90 | Ga0415639_010880 | 3300038395 | Bacteria | 23416 |
| 91 | Ga0466693_087116 | 3300042592 | Bacteria | 2977 |
| 92 | Ga0466693_157640 | 3300042592 | Bacteria | 6221 |
| 93 | Ga0466691_005993 | 3300042593 | Bacteria | 4582 |
| 94 | Ga0466694_157648 | 3300042594 | Bacteria | 4131 |
| 95 | Ga0466695_095072 | 3300042595 | Archaea | 3123 |
| 96 | Ga0466696_115180 | 3300042596 | Bacteria | 8257 |
| 97 | Ga0466699_191529 | 3300042597 | Bacteria | 2439 |
| 98 | Ga0123357_10011448 | 3300009784 | Bacteria | 11379 |
| 99 | Ga0123355_10000680 | 3300009826 | Bacteria | 46281 |
| 100 | Ga0123355_10001815 | 3300009826 | Bacteria | 29855 |
| 101 | Ga0123355_10004164 | 3300009826 | Bacteria | 20995 |
| 102 | Ga0123355_10066504 | 3300009826 | Bacteria | 5802 |
| 103 | Ga0123355_10131604 | 3300009826 | Unclassified | 3853 |
| 104 | Ga0123355_10137563 | 3300009826 | Bacteria | 3748 |
| 105 | Ga0123355_10170821 | 3300009826 | Bacteria | 3250 |
| 106 | Ga0123355_10346902 | 3300009826 | Unclassified | 1972 |
| 107 | Ga0123355_10380498 | 3300009826 | Unclassified | 1840 |
| 108 | Ga0123356_10001771 | 3300010049 | Bacteria | 23561 |
| 109 | Ga0123356_10008686 | 3300010049 | Bacteria | 10076 |
| 110 | Ga0123356_10040768 | 3300010049 | Bacteria | 4325 |
| 111 | Ga0123356_10096344 | 3300010049 | Archaea | 2829 |
| 112 | Ga0123356_10112005 | 3300010049 | Bacteria | 2638 |
| 113 | Ga0123356_10163697 | 3300010049 | Bacteria | 2226 |
| 114 | Ga0123356_10207178 | 3300010049 | Unclassified | 2006 |
| 115 | Ga0123353_10000993 | 3300010167 | Bacteria | 34793 |
| 116 | Ga0123353_10003050 | 3300010167 | Bacteria | 20970 |
| 117 | Ga0123353_10003642 | 3300010167 | Bacteria | 19536 |
| 118 | Ga0123353_10005027 | 3300010167 | Bacteria | 17246 |
| 119 | Ga0123353_10005075 | 3300010167 | Unclassified | 17182 |
| 120 | Ga0123353_10008551 | 3300010167 | Bacteria | 13997 |
| 121 | Ga0123353_10010003 | 3300010167 | Bacteria | 13168 |
| 122 | Ga0123353_10026932 | 3300010167 | Bacteria | 8797 |
| 123 | Ga0123353_10054047 | 3300010167 | Bacteria | 6420 |
| 124 | Ga0123353_10108981 | 3300010167 | Bacteria | 4462 |
| 125 | Ga0123353_10123468 | 3300010167 | Bacteria | 4162 |
| 126 | Ga0123353_10389261 | 3300010167 | Archaea | 2081 |
| 127 | IMNBL1DRAFT_c0012489 | 3300000062 | Unclassified | 3879 |
| 128 | JGI24695J34938_10000690 | 3300002450 | Bacteria | 31868 |
| 129 | JGI24702J35022_10000510 | 3300002462 | Bacteria | 23541 |
| 130 | JGI24702J35022_10006010 | 3300002462 | Bacteria | 7050 |
| 131 | JGI24702J35022_10018396 | 3300002462 | Bacteria | 3811 |
| 132 | JGI24702J35022_10039614 | 3300002462 | Bacteria | 2514 |
| 133 | JGI24702J35022_10067606 | 3300002462 | Unclassified | 1919 |
| 134 | JGI24703J35330_11748712 | 3300002501 | Bacteria | 27905 |
| 135 | JGI24705J35276_12184859 | 3300002504 | Unclassified | 1404 |
| 136 | JGI24705J35276_12233256 | 3300002504 | Archaea | 4747 |
| 137 | JGI24696J40584_12961358 | 3300002834 | Bacteria | 14174 |
| 138 | Ga0068305_10220819 | 3300005083 | Bacteria | 3971 |
| 139 | Ga0466697_197858 | 3300042611 | Bacteria | 4483 |
| 140 | Ga0466732_385097 | 3300042656 | Bacteria | 1747 |
| 141 | Ga0466733_149835 | 3300042659 | Bacteria | 4943 |
| 142 | Ga0466711_044854 | 3300042615 | Bacteria | 14007 |
| 143 | Ga0466726_139464 | 3300042619 | Bacteria | 4565 |
| 144 | Ga0466700_098408 | 3300042600 | Bacteria | 3081 |
| 145 | Ga0466700_363684 | 3300042600 | Bacteria | 2640 |
| 146 | Ga0466700_395135 | 3300042600 | Unclassified | 2335 |
| 147 | Ga0466707_276073 | 3300042601 | Bacteria | 1887 |
| 148 | Ga0466714_044036 | 3300042603 | Bacteria | 12027 |
| 149 | Ga0466721_039000 | 3300042608 | Bacteria | 18585 |
| 150 | Ga0466734_027242 | 3300042623 | Bacteria | 1556 |
| 151 | Ga0466734_165460 | 3300042623 | Bacteria | 3945 |
| 152 | Ga0466709_208458 | 3300042648 | Bacteria | 7726 |
| 153 | Ga0466708_125005 | 3300042652 | Bacteria | 4170 |
| 154 | Ga0415639_040931 | 3300038395 | Bacteria | 2469 |
| 155 | Ga0466657_052853 | 3300042582 | Bacteria | 7606 |
| 156 | Ga0466694_016232 | 3300042594 | Bacteria | 2519 |
| 157 | Ga0466694_324214 | 3300042594 | Archaea | 3217 |
| 158 | Ga0466701_008631 | 3300042598 | Bacteria | 14466 |
| 159 | Ga0123355_10000293 | 3300009826 | Bacteria | 64130 |
| 160 | Ga0123355_10001953 | 3300009826 | Bacteria | 29084 |
| 161 | Ga0123355_10003097 | 3300009826 | Bacteria | 23723 |
| 162 | Ga0123355_10004328 | 3300009826 | Bacteria | 20656 |
| 163 | Ga0123355_10037519 | 3300009826 | Bacteria | 7879 |
| 164 | Ga0123355_10039383 | 3300009826 | Bacteria | 7689 |
| 165 | Ga0123355_10150823 | 3300009826 | Bacteria | 3532 |
| 166 | Ga0123355_10252854 | 3300009826 | Bacteria | 2477 |
| 167 | Ga0123356_10004617 | 3300010049 | Bacteria | 14187 |
| 168 | Ga0123356_10010490 | 3300010049 | Bacteria | 9092 |
| 169 | Ga0123356_10020224 | 3300010049 | Bacteria | 6301 |
| 170 | Ga0123356_10029569 | 3300010049 | Unclassified | 5131 |
| 171 | Ga0123356_10029939 | 3300010049 | Bacteria | 5096 |
| 172 | Ga0123356_10036585 | 3300010049 | Unclassified | 4584 |
| 173 | Ga0123356_10076009 | 3300010049 | Bacteria | 3165 |
| 174 | Ga0123356_10085854 | 3300010049 | Bacteria | 2986 |
| 175 | Ga0123356_10263989 | 3300010049 | Bacteria | 1807 |
| 176 | Ga0123356_10391867 | 3300010049 | Bacteria | 1524 |
| 177 | Ga0123353_10003881 | 3300010167 | Bacteria | 19091 |
| 178 | Ga0123353_10011852 | 3300010167 | Bacteria | 12324 |
| 179 | Ga0123353_10019540 | 3300010167 | Bacteria | 10073 |
| 180 | Ga0123353_10025699 | 3300010167 | Bacteria | 8979 |
| 181 | Ga0123353_10031562 | 3300010167 | Archaea | 8208 |
| 182 | Ga0123353_10035427 | 3300010167 | Bacteria | 7803 |
| 183 | Ga0123353_10097510 | 3300010167 | Bacteria | 4738 |
| 184 | Ga0123353_10114813 | 3300010167 | Bacteria | 4335 |
| 185 | Ga0123353_10116741 | 3300010167 | Archaea | 4294 |
| 186 | Ga0123353_10127992 | 3300010167 | Bacteria | 4078 |
| 187 | Ga0123353_10137359 | 3300010167 | Bacteria | 3920 |
| 188 | Ga0123353_10138433 | 3300010167 | Bacteria | 3902 |
| 189 | Ga0123353_10228969 | 3300010167 | Bacteria | 2900 |
| 190 | Ga0123353_10305184 | 3300010167 | Bacteria | 2427 |
| 191 | Ga0123353_10328280 | 3300010167 | Archaea | 2318 |
| 192 | Ga0123353_10460436 | 3300010167 | Archaea | 1869 |
| 193 | Ga0123354_10163864 | 3300010882 | Unclassified | 2624 |
| 194 | Ga0123354_10256635 | 3300010882 | Bacteria | 1757 |
| 195 | JGI24698J34947_10003599 | 3300002449 | Bacteria | 8417 |
| 196 | JGI24695J34938_10002600 | 3300002450 | Bacteria | 13590 |
| 197 | JGI24695J34938_10003277 | 3300002450 | Bacteria | 11420 |
| 198 | JGI24695J34938_10004338 | 3300002450 | Bacteria | 9345 |
| 199 | JGI24695J34938_10006434 | 3300002450 | Bacteria | 7054 |
| 200 | JGI24702J35022_10000249 | 3300002462 | Bacteria | 30679 |
| 201 | JGI24702J35022_10006590 | 3300002462 | Bacteria | 6706 |
| 202 | JGI24702J35022_10008271 | 3300002462 | Archaea | 5898 |
| 203 | JGI24705J35276_12237096 | 3300002504 | Bacteria | 9800 |
| 204 | Ga0072941_1022085 | 3300005201 | Bacteria | 12064 |
| 205 | Ga0072941_1309773 | 3300005201 | Bacteria | 2418 |
| 206 | Ga0466705_264233 | 3300042612 | Bacteria | 10858 |
| 207 | Ga0466710_045739 | 3300042613 | Bacteria | 35503 |
| 208 | Ga0466710_334880 | 3300042613 | Archaea | 4929 |
| 209 | Ga0466712_113127 | 3300042614 | Bacteria | 13704 |
| 210 | Ga0466715_271362 | 3300042616 | Bacteria | 20266 |
| 211 | Ga0466718_079773 | 3300042617 | Bacteria | 28796 |
| 212 | Ga0466713_105299 | 3300042602 | Bacteria | 19535 |
| 213 | Ga0466717_107541 | 3300042604 | Unclassified | 8604 |
| 214 | Ga0466720_075734 | 3300042607 | Bacteria | 2025 |
| 215 | Ga0466720_193693 | 3300042607 | Bacteria | 4646 |
| 216 | Ga0466721_081304 | 3300042608 | Bacteria | 5269 |
| 217 | Ga0466721_081844 | 3300042608 | Bacteria | 33835 |
| 218 | Ga0466721_242952 | 3300042608 | Bacteria | 10639 |
| 219 | Ga0466722_222931 | 3300042609 | Bacteria | 2899 |
| 220 | Ga0466697_004761 | 3300042611 | Bacteria | 1788 |
| 221 | Ga0466731_027785 | 3300042622 | Bacteria | 46356 |
| 222 | Ga0466731_224156 | 3300042622 | Bacteria | 5663 |
| 223 | Ga0466734_033824 | 3300042623 | Bacteria | 2770 |
| 224 | Ga0466734_165774 | 3300042623 | Bacteria | 2748 |
| 225 | Ga0466735_182004 | 3300042624 | Bacteria | 4365 |
| 226 | Ga0466735_206270 | 3300042624 | Bacteria | 2267 |
| 227 | Ga0466730_039408 | 3300042625 | Bacteria | 1927 |
| 228 | Ga0466703_342458 | 3300042636 | Unclassified | 3145 |
| 229 | Ga0466708_046893 | 3300042652 | Bacteria | 6208 |
| 230 | Ga0466725_176145 | 3300042654 | Bacteria | 20828 |
| 231 | Ga0466725_182534 | 3300042654 | Bacteria | 1694 |
| 232 | Ga0466727_262470 | 3300042655 | Bacteria | 2956 |
| 233 | Ga0415639_000550 | 3300038395 | Bacteria | 24503 |
| 234 | Ga0415639_002079 | 3300038395 | Bacteria | 99204 |
| 235 | Ga0415639_020916 | 3300038395 | Bacteria | 3622 |
| 236 | Ga0415639_044334 | 3300038395 | Bacteria | 13913 |
| 237 | Ga0466657_083009 | 3300042582 | Unclassified | 6654 |
| 238 | Ga0466657_203684 | 3300042582 | Archaea | 2209 |
| 239 | Ga0466657_241792 | 3300042582 | Bacteria | 10337 |
| 240 | Ga0466690_124431 | 3300042590 | Unclassified | 2270 |
| 241 | Ga0466693_202178 | 3300042592 | Bacteria | 2085 |
| 242 | Ga0466691_128204 | 3300042593 | Bacteria | 5981 |
| 243 | Ga0466694_038799 | 3300042594 | Bacteria | 75355 |
| 244 | Ga0466694_199493 | 3300042594 | Bacteria | 8424 |
| 245 | Ga0466696_127610 | 3300042596 | Bacteria | 8195 |
| 246 | Ga0123357_10024189 | 3300009784 | Bacteria | 8172 |
| 247 | Ga0123355_10000245 | 3300009826 | Bacteria | 69826 |
| 248 | Ga0123355_10001238 | 3300009826 | Bacteria | 35605 |
| 249 | Ga0123355_10001411 | 3300009826 | Bacteria | 33534 |
| 250 | Ga0123355_10002042 | 3300009826 | Bacteria | 28510 |
| 251 | Ga0123355_10062035 | 3300009826 | Bacteria | 6035 |
| 252 | Ga0123355_10073332 | 3300009826 | Bacteria | 5487 |
| 253 | Ga0123355_10142857 | 3300009826 | Bacteria | 3657 |
| 254 | Ga0123355_10244390 | 3300009826 | Bacteria | 2537 |
| 255 | Ga0123355_10322268 | 3300009826 | Bacteria | 2081 |
| 256 | Ga0123355_10328519 | 3300009826 | Bacteria | 2052 |
| 257 | Ga0123356_10000004 | 3300010049 | Bacteria | 279505 |
| 258 | Ga0123356_10000052 | 3300010049 | Bacteria | 124725 |
| 259 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 260 | Ga0123356_10000284 | 3300010049 | Bacteria | 58450 |
| 261 | Ga0123356_10003033 | 3300010049 | Bacteria | 17740 |
| 262 | Ga0123356_10003801 | 3300010049 | Bacteria | 15719 |
| 263 | Ga0123356_10004708 | 3300010049 | Bacteria | 14053 |
| 264 | Ga0123356_10004746 | 3300010049 | Bacteria | 14005 |
| 265 | Ga0123356_10012241 | 3300010049 | Bacteria | 8337 |
| 266 | Ga0123356_10020354 | 3300010049 | Archaea | 6279 |
| 267 | Ga0123356_10033617 | 3300010049 | Bacteria | 4795 |
| 268 | Ga0123356_10037374 | 3300010049 | Archaea | 4531 |
| 269 | Ga0123356_10059323 | 3300010049 | Archaea | 3569 |
| 270 | Ga0123353_10000089 | 3300010167 | Bacteria | 102894 |
| 271 | Ga0123353_10007358 | 3300010167 | Unclassified | 14860 |
| 272 | Ga0123353_10021504 | 3300010167 | Bacteria | 9686 |
| 273 | Ga0123353_10033562 | 3300010167 | Bacteria | 7995 |
| 274 | Ga0123353_10035266 | 3300010167 | Bacteria | 7820 |
| 275 | Ga0123353_10088862 | 3300010167 | Bacteria | 4976 |
| 276 | Ga0123353_10090109 | 3300010167 | Unclassified | 4939 |
| 277 | Ga0123353_10109700 | 3300010167 | Bacteria | 4446 |
| 278 | Ga0123353_10146156 | 3300010167 | Bacteria | 3780 |
| 279 | Ga0123353_10149791 | 3300010167 | Bacteria | 3726 |
| 280 | Ga0123353_10225854 | 3300010167 | Bacteria | 2923 |
| 281 | Ga0123353_10299006 | 3300010167 | Bacteria | 2458 |
| 282 | Ga0123353_10579549 | 3300010167 | Bacteria | 1610 |
| 283 | JGI24698J34947_10012245 | 3300002449 | Unclassified | 4704 |
| 284 | JGI24695J34938_10008092 | 3300002450 | Bacteria | 6052 |
| 285 | JGI24695J34938_10020275 | 3300002450 | Bacteria | 3275 |
| 286 | JGI24702J35022_10004518 | 3300002462 | Bacteria | 8253 |
| 287 | JGI24702J35022_10008811 | 3300002462 | Bacteria | 5694 |
| 288 | Ga0123357_10002607 | 3300009784 | Unclassified | 20249 |
| 289 | Ga0466705_027135 | 3300042612 | Bacteria | 6427 |
| 290 | Ga0466711_296617 | 3300042615 | Bacteria | 4778 |
| 291 | Ga0466715_064477 | 3300042616 | Bacteria | 18975 |
| 292 | Ga0466723_189559 | 3300042618 | Bacteria | 7492 |
| 293 | Ga0466726_308999 | 3300042619 | Unclassified | 22636 |
| 294 | Ga0466701_049559 | 3300042598 | Bacteria | 1864 |
| 295 | Ga0466701_061352 | 3300042598 | Archaea | 3001 |
| 296 | Ga0466701_074915 | 3300042598 | Bacteria | 1808 |
| 297 | Ga0466700_194446 | 3300042600 | Bacteria | 1725 |
| 298 | Ga0466717_171323 | 3300042604 | Archaea | 1983 |
| 299 | Ga0466717_214358 | 3300042604 | Bacteria | 2428 |
| 300 | Ga0466731_094150 | 3300042622 | Bacteria | 14819 |
| 301 | Ga0466731_190633 | 3300042622 | Bacteria | 8064 |
| 302 | Ga0466734_162510 | 3300042623 | Bacteria | 2225 |
| 303 | Ga0466704_219357 | 3300042643 | Bacteria | 26789 |
| 304 | Ga0466709_396056 | 3300042648 | Bacteria | 40552 |
| 305 | Ga0466724_56859 | 3300042649 | Bacteria | 1591 |
| 306 | Ga0415639_001691 | 3300038395 | Bacteria | 20879 |
| 307 | Ga0415639_019850 | 3300038395 | Bacteria | 22637 |
| 308 | Ga0466657_400531 | 3300042582 | Bacteria | 38065 |
| 309 | Ga0466692_014618 | 3300042591 | Bacteria | 107882 |
| 310 | Ga0466694_017032 | 3300042594 | Bacteria | 12535 |
| 311 | Ga0466694_098965 | 3300042594 | Unclassified | 6299 |
| 312 | Ga0466695_196515 | 3300042595 | Bacteria | 2734 |
| 313 | Ga0466696_340176 | 3300042596 | Bacteria | 7125 |
| 314 | Ga0123355_10008833 | 3300009826 | Bacteria | 15249 |
| 315 | Ga0123355_10010329 | 3300009826 | Bacteria | 14292 |
| 316 | Ga0123355_10030165 | 3300009826 | Bacteria | 8786 |
| 317 | Ga0123355_10060756 | 3300009826 | Bacteria | 6102 |
| 318 | Ga0123355_10074140 | 3300009826 | Archaea | 5452 |
| 319 | Ga0123355_10136582 | 3300009826 | Bacteria | 3764 |
| 320 | Ga0123355_10368309 | 3300009826 | Bacteria | 1885 |
| 321 | Ga0123356_10000155 | 3300010049 | Unclassified | 77400 |
| 322 | Ga0123356_10001685 | 3300010049 | Bacteria | 24188 |
| 323 | Ga0123356_10009462 | 3300010049 | Bacteria | 9620 |
| 324 | Ga0123356_10019346 | 3300010049 | Bacteria | 6454 |
| 325 | Ga0123356_10020039 | 3300010049 | Bacteria | 6334 |
| 326 | Ga0123356_10020453 | 3300010049 | Bacteria | 6263 |
| 327 | Ga0123356_10036266 | 3300010049 | Bacteria | 4605 |
| 328 | Ga0123356_10040143 | 3300010049 | Bacteria | 4361 |
| 329 | Ga0123356_10040917 | 3300010049 | Archaea | 4318 |
| 330 | Ga0123356_10068815 | 3300010049 | Bacteria | 3318 |
| 331 | Ga0123356_10094209 | 3300010049 | Bacteria | 2859 |
| 332 | Ga0123356_10124142 | 3300010049 | Archaea | 2517 |
| 333 | Ga0123356_10128945 | 3300010049 | Bacteria | 2475 |
| 334 | Ga0123356_10164874 | 3300010049 | Unclassified | 2219 |
| 335 | Ga0123353_10006047 | 3300010167 | Bacteria | 16039 |
| 336 | Ga0123353_10009775 | 3300010167 | Bacteria | 13289 |
| 337 | Ga0123353_10010906 | 3300010167 | Bacteria | 12735 |
| 338 | Ga0123353_10022447 | 3300010167 | Bacteria | 9518 |
| 339 | Ga0123353_10039388 | 3300010167 | Bacteria | 7439 |
| 340 | Ga0123353_10067634 | 3300010167 | Unclassified | 5737 |
| 341 | Ga0123353_10083288 | 3300010167 | Bacteria | 5146 |
| 342 | Ga0123353_10099717 | 3300010167 | Unclassified | 4681 |
| 343 | Ga0123353_10109709 | 3300010167 | Bacteria | 4445 |
| 344 | Ga0123353_10192539 | 3300010167 | Archaea | 3217 |
| 345 | Ga0123353_10219740 | 3300010167 | Archaea | 2972 |
| 346 | Ga0123353_10265661 | 3300010167 | Bacteria | 2648 |
| 347 | Ga0123353_10277372 | 3300010167 | Archaea | 2577 |
| 348 | Ga0123353_10430156 | 3300010167 | Archaea | 1952 |
| 349 | Ga0123353_10437505 | 3300010167 | Bacteria | 1931 |
| 350 | Ga0123354_10009680 | 3300010882 | Archaea | 14794 |
| 351 | Ga0123354_10097616 | 3300010882 | Archaea | 4002 |
| 352 | Ga0123354_10113178 | 3300010882 | Bacteria | 3567 |
| 353 | 2227480215 | 2225789004 | Bacteria | 4463 |
| 354 | JGI24702J35022_10048730 | 3300002462 | Bacteria | 2256 |
| 355 | JGI24703J35330_11742059 | 3300002501 | Bacteria | 3639 |
| 356 | JGI24703J35330_11744940 | 3300002501 | Bacteria | 4368 |
| 357 | JGI24703J35330_11748310 | 3300002501 | Bacteria | 13651 |
| 358 | Ga0072941_1000968 | 3300005201 | Bacteria | 33336 |
| 359 | Ga0072941_1024023 | 3300005201 | Bacteria | 23668 |
| 360 | Ga0072941_1113360 | 3300005201 | Unclassified | 3575 |
| 361 | Ga0466697_260828 | 3300042611 | Bacteria | 8733 |
| 362 | Ga0466733_100045 | 3300042659 | Bacteria | 26507 |
| 363 | Ga0466710_026790 | 3300042613 | Bacteria | 16759 |
| 364 | Ga0466710_403074 | 3300042613 | Bacteria | 18106 |
| 365 | Ga0466723_015312 | 3300042618 | Bacteria | 5775 |
| 366 | Ga0466728_004762 | 3300042620 | Bacteria | 2653 |
| 367 | Ga0466713_126009 | 3300042602 | Bacteria | 2032 |
| 368 | Ga0466721_027898 | 3300042608 | Bacteria | 112473 |
| 369 | Ga0466721_062871 | 3300042608 | Bacteria | 17486 |
| 370 | Ga0466721_288404 | 3300042608 | Bacteria | 3227 |
| 371 | Ga0466721_328002 | 3300042608 | Bacteria | 14422 |
| 372 | Ga0466731_051466 | 3300042622 | Bacteria | 7490 |
| 373 | Ga0466731_347933 | 3300042622 | Bacteria | 3784 |
| 374 | Ga0466731_388614 | 3300042622 | Bacteria | 2891 |
| 375 | Ga0466709_296915 | 3300042648 | Bacteria | 42178 |
| 376 | Ga0466725_144092 | 3300042654 | Bacteria | 2219 |
| 377 | Ga0466727_248886 | 3300042655 | Bacteria | 5703 |
| 378 | Ga0466656_182890 | 3300042550 | Bacteria | 4688 |
| 379 | Ga0466690_015017 | 3300042590 | Unclassified | 3441 |
| 380 | Ga0466692_072585 | 3300042591 | Bacteria | 29111 |
| 381 | Ga0466691_063915 | 3300042593 | Bacteria | 2851 |
| 382 | Ga0466694_125426 | 3300042594 | Bacteria | 1631 |
| 383 | Ga0466695_097605 | 3300042595 | Bacteria | 6439 |
| 384 | Ga0466699_139708 | 3300042597 | Unclassified | 2112 |
| 385 | Ga0123355_10000025 | 3300009826 | Bacteria | 148009 |
| 386 | Ga0123355_10003356 | 3300009826 | Bacteria | 22920 |
| 387 | Ga0123355_10004223 | 3300009826 | Bacteria | 20862 |
| 388 | Ga0123355_10011939 | 3300009826 | Bacteria | 13425 |
| 389 | Ga0123355_10013736 | 3300009826 | Bacteria | 12617 |
| 390 | Ga0123355_10015625 | 3300009826 | Bacteria | 11934 |
| 391 | Ga0123355_10029955 | 3300009826 | Bacteria | 8818 |
| 392 | Ga0123355_10036299 | 3300009826 | Bacteria | 8014 |
| 393 | Ga0123356_10000319 | 3300010049 | Bacteria | 55244 |
| 394 | Ga0123356_10002031 | 3300010049 | Bacteria | 21842 |
| 395 | Ga0123356_10014270 | 3300010049 | Bacteria | 7642 |
| 396 | Ga0123356_10023763 | 3300010049 | Bacteria | 5767 |
| 397 | Ga0123356_10024558 | 3300010049 | Bacteria | 5670 |
| 398 | Ga0123356_10072401 | 3300010049 | Unclassified | 3238 |
| 399 | Ga0123356_10113093 | 3300010049 | Unclassified | 2626 |
| 400 | Ga0123356_10153350 | 3300010049 | Bacteria | 2291 |
| 401 | Ga0123353_10000097 | 3300010167 | Bacteria | 100665 |
| 402 | Ga0123353_10000612 | 3300010167 | Bacteria | 43701 |
| 403 | Ga0123353_10001328 | 3300010167 | Bacteria | 30292 |
| 404 | Ga0123353_10004103 | 3300010167 | Bacteria | 18663 |
| 405 | Ga0123353_10008199 | 3300010167 | Bacteria | 14231 |
| 406 | Ga0123353_10015591 | 3300010167 | Bacteria | 11054 |
| 407 | Ga0123353_10021675 | 3300010167 | Unclassified | 9650 |
| 408 | Ga0123353_10171069 | 3300010167 | Bacteria | 3449 |
| 409 | Ga0123353_10461437 | 3300010167 | Bacteria | 1866 |
| 410 | Ga0123353_10632635 | 3300010167 | Bacteria | 1520 |
| 411 | Ga0123354_10016831 | 3300010882 | Bacteria | 11451 |
| 412 | Ga0123354_10104463 | 3300010882 | Bacteria | 3799 |
| 413 | Ga0123354_10168125 | 3300010882 | Bacteria | 2566 |
| 414 | JGI24702J35022_10011556 | 3300002462 | Bacteria | 4919 |
| 415 | Ga0068302_10698201 | 3300005071 | Unclassified | 1740 |
| 416 | Ga0466718_029011 | 3300042617 | Bacteria | 1657 |
| 417 | Ga0466726_084838 | 3300042619 | Bacteria | 19526 |
| 418 | Ga0466701_053322 | 3300042598 | Bacteria | 16524 |
| 419 | Ga0466701_077605 | 3300042598 | Bacteria | 1459 |
| 420 | Ga0466700_226299 | 3300042600 | Bacteria | 2873 |
| 421 | Ga0466700_448787 | 3300042600 | Bacteria | 7971 |
| 422 | Ga0466722_181941 | 3300042609 | Bacteria | 4001 |
| 423 | Ga0466698_323600 | 3300042610 | Bacteria | 2238 |
| 424 | Ga0466731_015227 | 3300042622 | Bacteria | 7783 |
| 425 | Ga0466731_026344 | 3300042622 | Unclassified | 2095 |
| 426 | Ga0466735_117658 | 3300042624 | Bacteria | 8403 |
| 427 | Ga0466735_122876 | 3300042624 | Bacteria | 4398 |
| 428 | Ga0466703_213581 | 3300042636 | Bacteria | 1939 |
| 429 | Ga0466703_399485 | 3300042636 | Unclassified | 2838 |
| 430 | Ga0466725_014086 | 3300042654 | Bacteria | 22027 |
| 431 | Ga0466725_171955 | 3300042654 | Archaea | 2172 |
| 432 | Ga0466727_081946 | 3300042655 | Bacteria | 4526 |
| 433 | Ga0466727_321186 | 3300042655 | Bacteria | 4049 |
| 434 | Ga0415639_074003 | 3300038395 | Bacteria | 4138 |
| 435 | Ga0466656_260840 | 3300042550 | Bacteria | 3363 |
| 436 | Ga0466657_029165 | 3300042582 | Bacteria | 9335 |
| 437 | Ga0466694_134207 | 3300042594 | Bacteria | 1667 |
| 438 | Ga0466694_187405 | 3300042594 | Bacteria | 42474 |
| 439 | Ga0466695_323361 | 3300042595 | Bacteria | 2346 |
| 440 | Ga0466699_318633 | 3300042597 | Bacteria | 1672 |
| 441 | Ga0123357_10010964 | 3300009784 | Bacteria | 11575 |
| 442 | Ga0123357_10017086 | 3300009784 | Bacteria | 9588 |
| 443 | Ga0123355_10001988 | 3300009826 | Bacteria | 28865 |
| 444 | Ga0123355_10002192 | 3300009826 | Bacteria | 27553 |
| 445 | Ga0123355_10159769 | 3300009826 | Bacteria | 3398 |
| 446 | Ga0123355_10348426 | 3300009826 | Unclassified | 1965 |
| 447 | Ga0123356_10000117 | 3300010049 | Bacteria | 86612 |
| 448 | Ga0123356_10000374 | 3300010049 | Bacteria | 51005 |
| 449 | Ga0123356_10002363 | 3300010049 | Unclassified | 20264 |
| 450 | Ga0123356_10025457 | 3300010049 | Bacteria | 5562 |
| 451 | Ga0123356_10043521 | 3300010049 | Bacteria | 4181 |
| 452 | Ga0123356_10047928 | 3300010049 | Bacteria | 3976 |
| 453 | Ga0123356_10118152 | 3300010049 | Bacteria | 2574 |
| 454 | Ga0123356_10150043 | 3300010049 | Bacteria | 2313 |
| 455 | Ga0123356_10199599 | 3300010049 | Bacteria | 2039 |
| 456 | Ga0123353_10002097 | 3300010167 | Bacteria | 24643 |
| 457 | Ga0123353_10003222 | 3300010167 | Bacteria | 20556 |
| 458 | Ga0123353_10023617 | 3300010167 | Bacteria | 9314 |
| 459 | Ga0123353_10053985 | 3300010167 | Bacteria | 6423 |
| 460 | Ga0123353_10095175 | 3300010167 | Unclassified | 4799 |
| 461 | Ga0123353_10141199 | 3300010167 | Unclassified | 3858 |
| 462 | Ga0123353_10160034 | 3300010167 | Unclassified | 3586 |
| 463 | Ga0123353_10468054 | 3300010167 | Archaea | 1849 |
| 464 | Ga0123353_10471215 | 3300010167 | Bacteria | 1841 |
| 465 | Ga0123353_10595894 | 3300010167 | Archaea | 1581 |
| 466 | JGI24695J34938_10000636 | 3300002450 | Bacteria | 33490 |
| 467 | JGI24695J34938_10002338 | 3300002450 | Bacteria | 14606 |
| 468 | JGI24695J34938_10018814 | 3300002450 | Bacteria | 3439 |
| 469 | JGI24695J34938_10020493 | 3300002450 | Unclassified | 3253 |
| 470 | JGI24702J35022_10003065 | 3300002462 | Bacteria | 10106 |
| 471 | JGI24702J35022_10014542 | 3300002462 | Bacteria | 4342 |
| 472 | JGI24702J35022_10021978 | 3300002462 | Bacteria | 3457 |
| 473 | JGI24702J35022_10023253 | 3300002462 | Bacteria | 3351 |
| 474 | JGI24705J35276_12238471 | 3300002504 | Bacteria | 23366 |
| 475 | JGI24699J35502_11134090 | 3300002509 | Bacteria | 29402 |
| 476 | Ga0068302_10139569 | 3300005071 | Unclassified | 1593 |
| 477 | Ga0466705_473507 | 3300042612 | Bacteria | 8589 |
| 478 | Ga0466710_430191 | 3300042613 | Bacteria | 2870 |
| 479 | Ga0466723_374186 | 3300042618 | Bacteria | 6332 |
| 480 | Ga0466726_075185 | 3300042619 | Unclassified | 5556 |
| 481 | Ga0466729_031002 | 3300042621 | Bacteria | 1603 |
| 482 | Ga0466701_039718 | 3300042598 | Bacteria | 3370 |
| 483 | Ga0466707_347728 | 3300042601 | Bacteria | 15670 |
| 484 | Ga0466717_036078 | 3300042604 | Unclassified | 3276 |
| 485 | Ga0466721_071107 | 3300042608 | Bacteria | 2371 |
| 486 | Ga0466721_114441 | 3300042608 | Bacteria | 14958 |
| 487 | Ga0466722_099400 | 3300042609 | Bacteria | 3052 |
| 488 | Ga0466722_211732 | 3300042609 | Bacteria | 1823 |
| 489 | Ga0466697_003164 | 3300042611 | Archaea | 100461 |
| 490 | Ga0466731_023562 | 3300042622 | Unclassified | 4141 |
| 491 | Ga0466731_351185 | 3300042622 | Bacteria | 3037 |
| 492 | Ga0466734_069726 | 3300042623 | Archaea | 27182 |
| 493 | Ga0466735_232718 | 3300042624 | Bacteria | 13061 |
| 494 | Ga0466702_045038 | 3300042635 | Unclassified | 2491 |
| 495 | Ga0466703_228745 | 3300042636 | Bacteria | 3534 |
| 496 | Ga0466709_115150 | 3300042648 | Bacteria | 104348 |
| 497 | Ga0466727_335877 | 3300042655 | Bacteria | 18561 |
| 498 | Ga0264413_162163 | 3300024493 | Bacteria | 2509 |
| 499 | Ga0466690_189770 | 3300042590 | Bacteria | 24524 |
| 500 | Ga0466693_014988 | 3300042592 | Bacteria | 15345 |
| 501 | Ga0466694_067243 | 3300042594 | Unclassified | 1565 |
| 502 | Ga0466694_187221 | 3300042594 | Unclassified | 2596 |
| 503 | Ga0466696_482284 | 3300042596 | Bacteria | 34716 |
| 504 | Ga0466699_230375 | 3300042597 | Unclassified | 3239 |
| 505 | Ga0123355_10000248 | 3300009826 | Bacteria | 69553 |
| 506 | Ga0123355_10000552 | 3300009826 | Bacteria | 50107 |
| 507 | Ga0123355_10004134 | 3300009826 | Bacteria | 21051 |
| 508 | Ga0123355_10005830 | 3300009826 | Bacteria | 18118 |
| 509 | Ga0123355_10008856 | 3300009826 | Unclassified | 15234 |
| 510 | Ga0123355_10010703 | 3300009826 | Unclassified | 14089 |
| 511 | Ga0123355_10010983 | 3300009826 | Bacteria | 13938 |
| 512 | Ga0123355_10012463 | 3300009826 | Unclassified | 13168 |
| 513 | Ga0123355_10135678 | 3300009826 | Bacteria | 3780 |
| 514 | Ga0123355_10324278 | 3300009826 | Bacteria | 2071 |
| 515 | Ga0123356_10000039 | 3300010049 | Bacteria | 138853 |
| 516 | Ga0123356_10000880 | 3300010049 | Bacteria | 33335 |
| 517 | Ga0123356_10001123 | 3300010049 | Bacteria | 29672 |
| 518 | Ga0123356_10001264 | 3300010049 | Bacteria | 27948 |
| 519 | Ga0123356_10007232 | 3300010049 | Bacteria | 11098 |
| 520 | Ga0123356_10007599 | 3300010049 | Bacteria | 10806 |
| 521 | Ga0123356_10022344 | 3300010049 | Bacteria | 5974 |
| 522 | Ga0123356_10022850 | 3300010049 | Bacteria | 5898 |
| 523 | Ga0123356_10068319 | 3300010049 | Bacteria | 3329 |
| 524 | Ga0123356_10074783 | 3300010049 | Bacteria | 3189 |
| 525 | Ga0123356_10079962 | 3300010049 | Bacteria | 3089 |
| 526 | Ga0123353_10000713 | 3300010167 | Bacteria | 40469 |
| 527 | Ga0123353_10001509 | 3300010167 | Bacteria | 28545 |
| 528 | Ga0123353_10002219 | 3300010167 | Bacteria | 24056 |
| 529 | Ga0123353_10110824 | 3300010167 | Bacteria | 4421 |
| 530 | Ga0123353_10148347 | 3300010167 | Bacteria | 3748 |
| 531 | Ga0123353_10202838 | 3300010167 | Bacteria | 3118 |
| 532 | Ga0123353_10275875 | 3300010167 | Bacteria | 2586 |
| 533 | Ga0123353_10412056 | 3300010167 | Bacteria | 2006 |
| 534 | Ga0123353_10576354 | 3300010167 | Bacteria | 1616 |
| 535 | IMNBL1DRAFT_c0013911 | 3300000062 | Bacteria | 3581 |
| 536 | JGI24695J34938_10000003 | 3300002450 | Bacteria | 167365 |
| 537 | JGI24695J34938_10004915 | 3300002450 | Bacteria | 8547 |
| 538 | JGI24702J35022_10000129 | 3300002462 | Bacteria | 37260 |
| 539 | JGI24702J35022_10000665 | 3300002462 | Bacteria | 20869 |
| 540 | JGI24702J35022_10023981 | 3300002462 | Bacteria | 3297 |
| 541 | JGI24703J35330_11715015 | 3300002501 | Archaea | 2255 |
| 542 | JGI24703J35330_11739245 | 3300002501 | Bacteria | 3277 |
| 543 | JGI24703J35330_11748785 | 3300002501 | Bacteria | 36162 |
| 544 | JGI24700J35501_10923807 | 3300002508 | Archaea | 5277 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.