Protein Family IF02581

Metagenome Isolate
115 Members
39 Samples
107 Scaffolds
113.37 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10731364|Ga0123355_107313643
Length
138 aa
Sequence
MSILSELNGLLVSILPVETGVFSGVPPDEYIVITPMADVFGVHADNFPQTETQEARLSLFSKNNYLERKNQVTKTLLSAEFVVTGRRYIGFESDTGYHHYNIDCEKFYMLNTDNSVYLSTGTRILTTGARFLLIREG*

πŸ“Š Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 55.3%
Kalotermitidae 18.4%
Unclassified 10.5%
Rhinotermitidae 7.9%
Termopsidae 5.3%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 2019105004 Actinobacterium Actino7 (unscreened) Isolate Unclassified
14 2065487017 Actinobacterium Actino7 (unscreened) Isolate Unclassified
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466725_349177 3300042654 Bacteria 1500
2 Ga0123355_10920573 3300009826 Bacteria 945
3 Ga0123356_10119480 3300010049 Bacteria 2561
4 Ga0123356_10376776 3300010049 Unclassified 1551
5 Ga0123356_11778650 3300010049 Bacteria 766
6 Ga0123353_10078461 3300010167 Unclassified 5307
7 Ga0123353_10507838 3300010167 Bacteria 1754
8 Ga0466706_051330 3300042599 Bacteria 1819
9 Ga0466706_136071 3300042599 Bacteria 3171
10 Ga0466717_089127 3300042604 Bacteria 1161
11 Ga0466726_118607 3300042619 Bacteria 1259
12 Ga0466729_194393 3300042621 Bacteria 2141
13 Ga0466696_011433 3300042596 Bacteria 1437
14 Ga0072941_1007442 3300005201 Bacteria 89058
15 Ga0466734_154021 3300042623 Bacteria 1139
16 Ga0466702_385429 3300042635 Bacteria 2060
17 Ga0466703_063898 3300042636 Bacteria 1580
18 Ga0466725_035920 3300042654 Bacteria 3492
19 Ga0466727_326176 3300042655 Bacteria 3386
20 Ga0123357_10833243 3300009784 Bacteria 614
21 Ga0123353_10009281 3300010167 Bacteria 13547
22 Ga0123353_10829673 3300010167 Bacteria 1271
23 Ga0123353_11042238 3300010167 Bacteria 1094
24 Ga0123353_12068081 3300010167 Bacteria 695
25 Ga0466706_207816 3300042599 Bacteria 4784
26 Ga0466700_054377 3300042600 Bacteria 1661
27 Ga0466700_113055 3300042600 Bacteria 1715
28 Ga0466717_309441 3300042604 Bacteria 2336
29 Ga0466711_261513 3300042615 Bacteria 44460
30 Ga0466726_471284 3300042619 Bacteria 1919
31 Ga0466729_133078 3300042621 Bacteria 31387
32 Ga0415639_002577 3300038395 Bacteria 3229
33 Ga0466692_077025 3300042591 Bacteria 2075
34 JGI24703J35330_11551390 3300002501 Bacteria 1228
35 Ga0072941_1161361 3300005201 Bacteria 895
36 Ga0072941_1576552 3300005201 Bacteria 816
37 Ga0466705_157387 3300042612 Bacteria 3639
38 Ga0123355_11677952 3300009826 Bacteria 607
39 Ga0123356_11408866 3300010049 Bacteria 857
40 Ga0123356_12382954 3300010049 Bacteria 662
41 Ga0123353_10259555 3300010167 Bacteria 2685
42 Ga0466719_424951 3300042606 Bacteria 2420
43 Ga0466723_037816 3300042618 Bacteria 1157
44 AustNasuHG_c1004911 3300000089 Bacteria 4788
45 AustNasuHG_c1068403 3300000089 Bacteria 650
46 JGI24705J35276_12228440 3300002504 Bacteria 3186
47 Ga0072940_1010731 3300005200 Bacteria 54200
48 Ga0123356_10095041 3300010049 Bacteria 2848
49 Ga0123356_10376926 3300010049 Bacteria 1550
50 Ga0123353_10003659 3300010167 Bacteria 19498
51 Ga0466706_088549 3300042599 Bacteria 1248
52 AustNasuHG_c1024018 3300000089 Bacteria 1938
53 JGI24703J35330_11748774 3300002501 Bacteria 33731
54 Ga0466703_152672 3300042636 Bacteria 4425
55 Ga0123355_10434676 3300009826 Bacteria 1666
56 Ga0123355_11111151 3300009826 Bacteria 821
57 Ga0123356_10060391 3300010049 Bacteria 3538
58 Ga0123356_12494908 3300010049 Bacteria 647
59 Ga0123353_10312933 3300010167 Bacteria 2388
60 Ga0123354_10887565 3300010882 Bacteria 587
61 Ga0466706_185875 3300042599 Bacteria 2838
62 Ga0466706_206020 3300042599 Bacteria 1615
63 Ga0466714_018373 3300042603 Bacteria 2480
64 Ga0466722_095627 3300042609 Bacteria 3521
65 Ga0466711_147516 3300042615 Bacteria 2072
66 Ga0466726_258791 3300042619 Bacteria 6619
67 Ga0466729_074075 3300042621 Bacteria 9292
68 Ga0415639_142706 3300038395 Unclassified 1624
69 Ga0466656_037215 3300042550 Bacteria 1684
70 Ga0466656_085063 3300042550 Bacteria 1068
71 Ga0466729_281572 3300042621 Bacteria 7192
72 Ga0466703_177100 3300042636 Bacteria 1233
73 Ga0466703_330020 3300042636 Bacteria 2069
74 Ga0123357_10340149 3300009784 Bacteria 1452
75 Ga0123356_10548570 3300010049 Bacteria 1317
76 Ga0123353_10001086 3300010167 Bacteria 33084
77 Ga0123353_10210003 3300010167 Bacteria 3054
78 Ga0466706_032313 3300042599 Unclassified 1009
79 Ga0466706_127643 3300042599 Bacteria 2015
80 Ga0466722_154774 3300042609 Bacteria 3215
81 Ga0466711_092848 3300042615 Bacteria 2166
82 Ga0415639_120207 3300038395 Bacteria 1693
83 AustNasuHG_c1023536 3300000089 Bacteria 1965
84 Ga0123357_10388060 3300009784 Bacteria 1287
85 Ga0123356_11209549 3300010049 Bacteria 921
86 Ga0123353_12783047 3300010167 Bacteria 573
87 Ga0466717_157974 3300042604 Bacteria 1181
88 Ga0466719_047643 3300042606 Bacteria 10760
89 Ga0466720_134662 3300042607 Bacteria 1148
90 Ga0466698_259077 3300042610 Bacteria 1763
91 Ga0466733_123451 3300042659 Bacteria 34754
92 Ga0466703_199214 3300042636 Bacteria 4441
93 Ga0466708_388971 3300042652 Bacteria 5217
94 Ga0466727_175260 3300042655 Bacteria 1687
95 Ga0123355_10731364 3300009826 Bacteria 1125
96 Ga0123356_10220304 3300010049 Bacteria 1953
97 Ga0123353_10030511 3300010167 Bacteria 8332
98 Ga0123353_10161332 3300010167 Unclassified 3569
99 Ga0123353_10436185 3300010167 Bacteria 1934
100 Ga0123353_13365129 3300010167 Unclassified 508
101 Ga0466706_127820 3300042599 Bacteria 1287
102 Ga0466706_166491 3300042599 Bacteria 4219
103 Ga0466713_015902 3300042602 Bacteria 2239
104 Ga0466714_039345 3300042603 Bacteria 2393
105 Ga0466711_462533 3300042615 Bacteria 8331
106 Ga0466729_017269 3300042621 Bacteria 1131
107 Ga0466699_408383 3300042597 Bacteria 2540

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_113055 Ga0466700_113055_1414_1695 93
2 3300042600 Ga0466700_113055 Ga0466700_113055_1414_1695 93
3 3300042615 Ga0466711_092848 Ga0466711_092848_220_534 104
4 3300009826 Ga0123355_11677952 Ga0123355_116779521 111
5 3300042615 Ga0466711_147516 Ga0466711_147516_1330_1665 111
6 3300042615 Ga0466711_147516 Ga0466711_147516_1330_1665 111
7 3300042654 Ga0466725_035920 Ga0466725_035920_2433_2768 111
8 3300038395 Ga0415639_142706 Ga0415639_142706_380_718 112
9 3300042550 Ga0466656_037215 Ga0466656_037215_378_716 112
10 3300042550 Ga0466656_085063 Ga0466656_085063_241_579 112
11 3300042591 Ga0466692_077025 Ga0466692_077025_904_1242 112
12 3300042597 Ga0466699_408383 Ga0466699_408383_2115_2453 112
13 3300042599 Ga0466706_088549 Ga0466706_088549_626_964 112
14 3300042599 Ga0466706_127643 Ga0466706_127643_385_723 112
15 3300042599 Ga0466706_127820 Ga0466706_127820_889_1227 112
16 3300042599 Ga0466706_136071 Ga0466706_136071_1771_2109 112
17 3300042599 Ga0466706_206020 Ga0466706_206020_1038_1376 112
18 3300042604 Ga0466717_309441 Ga0466717_309441_1018_1356 112
19 3300042609 Ga0466722_095627 Ga0466722_095627_1067_1405 112
20 3300042618 Ga0466723_037816 Ga0466723_037816_532_870 112
21 3300042621 Ga0466729_074075 Ga0466729_074075_3968_4306 112
22 3300042621 Ga0466729_194393 Ga0466729_194393_632_970 112
23 3300042623 Ga0466734_154021 Ga0466734_154021_471_809 112
24 3300042636 Ga0466703_152672 Ga0466703_152672_1623_1961 112
25 3300042636 Ga0466703_199214 Ga0466703_199214_3563_3901 112
26 3300042636 Ga0466703_330020 Ga0466703_330020_1191_1529 112
27 3300042654 Ga0466725_349177 Ga0466725_349177_985_1323 112
28 iso_pr_bacteria 2820131053 2820132283 112
29 3300000089 AustNasuHG_c1024018 AustNasuHG_10240184 113
30 3300000089 AustNasuHG_c1068403 AustNasuHG_10684032 113
31 3300002501 JGI24703J35330_11551390 JGI24703J35330_115513902 113
32 3300002501 JGI24703J35330_11748774 JGI24703J35330_1174877423 113
33 3300002504 JGI24705J35276_12228440 JGI24705J35276_122284404 113
34 3300005201 Ga0072941_1161361 Ga0072941_11613612 113
35 3300009784 Ga0123357_10340149 Ga0123357_103401492 113
36 3300009826 Ga0123355_10434676 Ga0123355_104346762 113
37 3300009826 Ga0123355_10920573 Ga0123355_109205732 113
38 3300010049 Ga0123356_10060391 Ga0123356_100603913 113
39 3300010049 Ga0123356_10119480 Ga0123356_101194804 113
40 3300010049 Ga0123356_10220304 Ga0123356_102203042 113
41 3300010049 Ga0123356_11209549 Ga0123356_112095492 113
42 3300010167 Ga0123353_10003659 Ga0123353_1000365922 113
43 3300010167 Ga0123353_10161332 Ga0123353_101613326 113
44 3300010167 Ga0123353_10210003 Ga0123353_102100036 113
45 3300010167 Ga0123353_10436185 Ga0123353_104361855 113
46 3300010167 Ga0123353_11042238 Ga0123353_110422382 113
47 3300010167 Ga0123353_12068081 Ga0123353_120680812 113
48 3300010882 Ga0123354_10887565 Ga0123354_108875652 113
49 3300038395 Ga0415639_002577 Ga0415639_002577_86_427 113
50 3300042596 Ga0466696_011433 Ga0466696_011433_1050_1391 113
51 3300042599 Ga0466706_032313 Ga0466706_032313_95_436 113
52 3300042599 Ga0466706_051330 Ga0466706_051330_426_767 113
53 3300042599 Ga0466706_166491 Ga0466706_166491_2586_2927 113
54 3300042599 Ga0466706_185875 Ga0466706_185875_2389_2730 113
55 3300042599 Ga0466706_207816 Ga0466706_207816_3410_3751 113
56 3300042602 Ga0466713_015902 Ga0466713_015902_1391_1732 113
57 3300042603 Ga0466714_039345 Ga0466714_039345_2010_2351 113
58 3300042604 Ga0466717_089127 Ga0466717_089127_774_1115 113
59 3300042606 Ga0466719_047643 Ga0466719_047643_7415_7756 113
60 3300042606 Ga0466719_424951 Ga0466719_424951_2005_2346 113
61 3300042609 Ga0466722_154774 Ga0466722_154774_1495_1836 113
62 3300042610 Ga0466698_259077 Ga0466698_259077_1034_1375 113
63 3300042612 Ga0466705_157387 Ga0466705_157387_2904_3245 113
64 3300042615 Ga0466711_261513 Ga0466711_261513_28263_28604 113
65 3300042615 Ga0466711_462533 Ga0466711_462533_7347_7688 113
66 3300042619 Ga0466726_118607 Ga0466726_118607_342_683 113
67 3300042619 Ga0466726_258791 Ga0466726_258791_3760_4101 113
68 3300042619 Ga0466726_471284 Ga0466726_471284_1483_1824 113
69 3300042621 Ga0466729_017269 Ga0466729_017269_238_579 113
70 3300042621 Ga0466729_281572 Ga0466729_281572_2216_2557 113
71 3300042635 Ga0466702_385429 Ga0466702_385429_1668_2009 113
72 3300042636 Ga0466703_063898 Ga0466703_063898_793_1134 113
73 3300042636 Ga0466703_177100 Ga0466703_177100_715_1056 113
74 3300042652 Ga0466708_388971 Ga0466708_388971_2834_3175 113
75 3300042655 Ga0466727_326176 Ga0466727_326176_1329_1670 113
76 3300042659 Ga0466733_123451 Ga0466733_123451_9993_10334 113
77 3300000089 AustNasuHG_c1004911 AustNasuHG_10049116 114
78 3300000089 AustNasuHG_c1023536 AustNasuHG_10235363 114
79 3300005200 Ga0072940_1010731 Ga0072940_101073136 114
80 3300005201 Ga0072941_1007442 Ga0072941_100744263 114
81 3300009784 Ga0123357_10833243 Ga0123357_108332431 114
82 3300009826 Ga0123355_11111151 Ga0123355_111111512 114
83 3300010049 Ga0123356_10376776 Ga0123356_103767763 114
84 3300010049 Ga0123356_10376926 Ga0123356_103769263 114
85 3300010049 Ga0123356_11778650 Ga0123356_117786501 114
86 3300010167 Ga0123353_10009281 Ga0123353_100092816 114
87 3300010167 Ga0123353_10030511 Ga0123353_100305116 114
88 3300010167 Ga0123353_10078461 Ga0123353_100784616 114
89 3300010167 Ga0123353_10829673 Ga0123353_108296732 114
90 3300038395 Ga0415639_120207 Ga0415639_120207_519_863 114
91 3300042603 Ga0466714_018373 Ga0466714_018373_236_580 114
92 3300042604 Ga0466717_157974 Ga0466717_157974_116_460 114
93 3300042607 Ga0466720_134662 Ga0466720_134662_51_395 114
94 iso_pr_bacteria 2019105004 2020342120 114
95 iso_pr_bacteria 2065487017 2067071021 114
96 3300005201 Ga0072941_1576552 Ga0072941_15765521 115
97 3300010049 Ga0123356_10095041 Ga0123356_100950415 115
98 3300010049 Ga0123356_10548570 Ga0123356_105485702 115
99 3300010049 Ga0123356_11408866 Ga0123356_114088662 115
100 3300010167 Ga0123353_10001086 Ga0123353_100010866 115
101 3300010167 Ga0123353_10259555 Ga0123353_102595555 115
102 3300010167 Ga0123353_12783047 Ga0123353_127830471 115
103 3300010167 Ga0123353_13365129 Ga0123353_133651291 115
104 3300042600 Ga0466700_054377 Ga0466700_054377_662_1009 115
105 3300042621 Ga0466729_133078 Ga0466729_133078_30412_30759 115
106 3300042655 Ga0466727_175260 Ga0466727_175260_452_799 115
107 3300009784 Ga0123357_10388060 Ga0123357_103880603 116
108 3300010049 Ga0123356_12382954 Ga0123356_123829542 116
109 3300010167 Ga0123353_10507838 Ga0123353_105078382 116
110 3300010167 Ga0123353_10507838 Ga0123353_105078382 116
111 3300010049 Ga0123356_12494908 Ga0123356_124949082 119
112 3300010049 Ga0123356_12494908 Ga0123356_124949082 119
113 3300010167 Ga0123353_10312933 Ga0123353_103129334 119
114 3300009826 Ga0123355_10731364 Ga0123355_107313643 138
115 3300009826 Ga0123355_10731364 Ga0123355_107313643 138

🧩 MSA Aligner

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.