Protein Family IF02566
Metagenome
Isolate
121
Members
37
Samples
111
Scaffolds
91.04
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10528283|Ga0123355_105282831
- Length
- 106 aa
- Sequence
- VQIKKAQILTLKKELFTMQEKFCESCGMPMGETDEMYGTELNGSKSVDYCKFCYNNGAFTNPNATLEETIELVAAMMVKDFGFSPEDAKEQCKAGIPNLKRWKTA*
Sample Types
Isolate
7.4%
Metagenome
92.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.1%
Unclassified
24.3%
Kalotermitidae
8.1%
Tenebrionidae
5.4%
Passalidae
5.4%
Termopsidae
2.7%
Taxonomy
Archaea
2
Bacteria
90
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 2 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 3 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 4 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 14 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 15 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 16 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 29 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 35 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10016376 | 3300009826 | Bacteria | 11682 |
| 2 | Ga0123355_10309791 | 3300009826 | Bacteria | 2142 |
| 3 | Ga0123355_10338174 | 3300009826 | Bacteria | 2009 |
| 4 | Ga0123355_10435245 | 3300009826 | Bacteria | 1665 |
| 5 | Ga0123355_10702293 | 3300009826 | Bacteria | 1161 |
| 6 | Ga0123355_10792874 | 3300009826 | Unclassified | 1059 |
| 7 | Ga0123355_11538351 | 3300009826 | Bacteria | 646 |
| 8 | Ga0466721_251692 | 3300042608 | Unclassified | 1749 |
| 9 | Ga0466724_18707 | 3300042649 | Bacteria | 1986 |
| 10 | Ga0466727_273712 | 3300042655 | Bacteria | 1304 |
| 11 | Ga0466715_521505 | 3300042616 | Bacteria | 2423 |
| 12 | Ga0466693_400207 | 3300042592 | Unclassified | 1517 |
| 13 | JGI24705J35276_12227876 | 3300002504 | Bacteria | 3080 |
| 14 | Ga0123355_10001658 | 3300009826 | Bacteria | 30972 |
| 15 | Ga0123355_10049858 | 3300009826 | Bacteria | 6805 |
| 16 | Ga0123355_10060910 | 3300009826 | Bacteria | 6094 |
| 17 | Ga0123355_10129944 | 3300009826 | Bacteria | 3883 |
| 18 | Ga0123355_10305076 | 3300009826 | Bacteria | 2165 |
| 19 | Ga0123355_10962496 | 3300009826 | Bacteria | 914 |
| 20 | Ga0123355_10971807 | 3300009826 | Unclassified | 907 |
| 21 | Ga0123353_11508759 | 3300010167 | Bacteria | 855 |
| 22 | Ga0466703_160140 | 3300042636 | Bacteria | 3477 |
| 23 | Ga0466725_398621 | 3300042654 | Bacteria | 1152 |
| 24 | Ga0466657_010449 | 3300042582 | Bacteria | 2834 |
| 25 | Ga0562379_0064 | 3300056790 | Bacteria | 452272 |
| 26 | Ga0123357_10665675 | 3300009784 | Unclassified | 763 |
| 27 | Ga0123355_10015228 | 3300009826 | Bacteria | 12073 |
| 28 | Ga0123355_10029652 | 3300009826 | Archaea | 8862 |
| 29 | Ga0123355_10220743 | 3300009826 | Bacteria | 2726 |
| 30 | Ga0123355_10763040 | 3300009826 | Bacteria | 1090 |
| 31 | Ga0123355_11110249 | 3300009826 | Unclassified | 821 |
| 32 | Ga0123355_11601846 | 3300009826 | Unclassified | 627 |
| 33 | Ga0123353_10000961 | 3300010167 | Archaea | 35227 |
| 34 | Ga0466700_116360 | 3300042600 | Bacteria | 1742 |
| 35 | Ga0466703_034534 | 3300042636 | Bacteria | 2650 |
| 36 | Ga0466725_129010 | 3300042654 | Bacteria | 35765 |
| 37 | IMNBL1DRAFT_c0005661 | 3300000062 | Bacteria | 7062 |
| 38 | JGI24703J35330_11714821 | 3300002501 | Unclassified | 2250 |
| 39 | Ga0123355_10000924 | 3300009826 | Bacteria | 40681 |
| 40 | Ga0123355_10001109 | 3300009826 | Bacteria | 37241 |
| 41 | Ga0123355_10001478 | 3300009826 | Bacteria | 32725 |
| 42 | Ga0123355_10479412 | 3300009826 | Bacteria | 1549 |
| 43 | Ga0123355_10779940 | 3300009826 | Bacteria | 1072 |
| 44 | Ga0123355_10793284 | 3300009826 | Unclassified | 1058 |
| 45 | Ga0123355_10853574 | 3300009826 | Bacteria | 1001 |
| 46 | Ga0123355_11595395 | 3300009826 | Unclassified | 629 |
| 47 | Ga0123353_13191855 | 3300010167 | Bacteria | 526 |
| 48 | Ga0466734_072145 | 3300042623 | Unclassified | 1413 |
| 49 | JGI24695J34938_10227424 | 3300002450 | Bacteria | 785 |
| 50 | Ga0123355_10000097 | 3300009826 | Bacteria | 93968 |
| 51 | Ga0123355_10002595 | 3300009826 | Bacteria | 25628 |
| 52 | Ga0123355_10025121 | 3300009826 | Bacteria | 9590 |
| 53 | Ga0123355_10040942 | 3300009826 | Bacteria | 7542 |
| 54 | Ga0123355_10112208 | 3300009826 | Unclassified | 4256 |
| 55 | Ga0123355_10124591 | 3300009826 | Bacteria | 3986 |
| 56 | Ga0123355_10394298 | 3300009826 | Unclassified | 1792 |
| 57 | Ga0123355_10402837 | 3300009826 | Bacteria | 1763 |
| 58 | Ga0123355_10490422 | 3300009826 | Unclassified | 1522 |
| 59 | Ga0466717_000166 | 3300042604 | Bacteria | 1634 |
| 60 | Ga0466734_139753 | 3300042623 | Bacteria | 15723 |
| 61 | Ga0466710_354993 | 3300042613 | Bacteria | 2761 |
| 62 | Ga0466711_475979 | 3300042615 | Bacteria | 1976 |
| 63 | Ga0466718_041114 | 3300042617 | Bacteria | 1839 |
| 64 | JGI24703J35330_10722409 | 3300002501 | Unclassified | 505 |
| 65 | Ga0123355_10017991 | 3300009826 | Bacteria | 11191 |
| 66 | Ga0123355_10041088 | 3300009826 | Bacteria | 7529 |
| 67 | Ga0123355_10041591 | 3300009826 | Bacteria | 7483 |
| 68 | Ga0123355_10060172 | 3300009826 | Bacteria | 6134 |
| 69 | Ga0123355_10125533 | 3300009826 | Bacteria | 3967 |
| 70 | Ga0123355_10167340 | 3300009826 | Bacteria | 3295 |
| 71 | Ga0123355_11004988 | 3300009826 | Bacteria | 885 |
| 72 | Ga0123355_11101250 | 3300009826 | Bacteria | 826 |
| 73 | Ga0123355_11399082 | 3300009826 | Unclassified | 692 |
| 74 | Ga0123355_11960439 | 3300009826 | Unclassified | 545 |
| 75 | Ga0123355_12224524 | 3300009826 | Unclassified | 500 |
| 76 | Ga0466701_044175 | 3300042598 | Bacteria | 1010 |
| 77 | Ga0466710_436040 | 3300042613 | Bacteria | 2172 |
| 78 | Ga0466656_093454 | 3300042550 | Bacteria | 1046 |
| 79 | Ga0466693_157409 | 3300042592 | Unclassified | 4950 |
| 80 | Ga0466693_413836 | 3300042592 | Bacteria | 1224 |
| 81 | 2227660734 | 2225789004 | Bacteria | 10485 |
| 82 | Ga0562375_0163 | 3300056856 | Bacteria | 195962 |
| 83 | Ga0123355_10009514 | 3300009826 | Bacteria | 14794 |
| 84 | Ga0123355_10152183 | 3300009826 | Bacteria | 3511 |
| 85 | Ga0123355_10249698 | 3300009826 | Bacteria | 2500 |
| 86 | Ga0123355_10343260 | 3300009826 | Bacteria | 1987 |
| 87 | Ga0123355_10707563 | 3300009826 | Unclassified | 1154 |
| 88 | Ga0123355_11313199 | 3300009826 | Unclassified | 724 |
| 89 | Ga0123353_10508620 | 3300010167 | Bacteria | 1752 |
| 90 | Ga0123354_10349497 | 3300010882 | Bacteria | 1320 |
| 91 | Ga0466727_228417 | 3300042655 | Bacteria | 24521 |
| 92 | 2227478219 | 2225789004 | Bacteria | 868 |
| 93 | JGI24695J34938_10196257 | 3300002450 | Unclassified | 840 |
| 94 | JGI24703J35330_11522290 | 3300002501 | Bacteria | 1161 |
| 95 | Ga0466697_246482 | 3300042611 | Unclassified | 1309 |
| 96 | Ga0123355_10011157 | 3300009826 | Unclassified | 13831 |
| 97 | Ga0123355_10031179 | 3300009826 | Bacteria | 8648 |
| 98 | Ga0123355_10056797 | 3300009826 | Bacteria | 6335 |
| 99 | Ga0123355_10193211 | 3300009826 | Unclassified | 2992 |
| 100 | Ga0123355_10241653 | 3300009826 | Bacteria | 2557 |
| 101 | Ga0123355_10292110 | 3300009826 | Unclassified | 2235 |
| 102 | Ga0123355_10372612 | 3300009826 | Bacteria | 1868 |
| 103 | Ga0123355_10528283 | 3300009826 | Unclassified | 1439 |
| 104 | Ga0123355_10663977 | 3300009826 | Unclassified | 1211 |
| 105 | Ga0123355_10746984 | 3300009826 | Bacteria | 1107 |
| 106 | Ga0123355_10922016 | 3300009826 | Unclassified | 944 |
| 107 | Ga0466700_250414 | 3300042600 | Bacteria | 6307 |
| 108 | Ga0466700_406025 | 3300042600 | Bacteria | 18685 |
| 109 | Ga0466703_143143 | 3300042636 | Bacteria | 2801 |
| 110 | Ga0466725_187504 | 3300042654 | Bacteria | 31004 |
| 111 | JGI24703J35330_11379350 | 3300002501 | Bacteria | 934 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12674 | Zn_ribbon_2 | Putative zinc ribbon domain | 22 | 103 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.