Protein Family IF02553
Metagenome
Isolate
154
Members
66
Samples
132
Scaffolds
315.18
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10435961|Ga0123355_104359612
- Length
- 360 aa
- Sequence
- MAMAHNLICAVFLNEERTTFVQKLSKFLVIHHCLMLIKEEPQMNSKVAVLIPCYNESLTIAKVVAEFKQALPNADIYVFDNNSTDGSDELAKSAGAIVHYEYKQGKGNVMRTMFRDIQADCYLMTDADDAFPADIAQSMINLILEGKADMVCGDRLSSTYFSQNKRRFHGAGNIIIKKLVNIFFGGNIKDIMTGYRAFSPLFVKTFPILSKGFEIETEMTIHALDKNLKIIEMPAQYRDRPEGSVSKLHTFKDGFKVLLTIFTLVKDYRPLPFFSLFALLLTALSGILFAPVFIEYLQTGLVPRFPTLIVSMFMLLSALLSLSCGLILDSLKRRERQEMEFKLNLMQMIRYSNANKEKK*
Sample Types
Isolate
14.3%
Metagenome
85.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.8%
Termitidae
24.6%
Kalotermitidae
21.5%
Apidae
9.2%
Termopsidae
4.6%
Rhinotermitidae
3.1%
Passalidae
1.5%
Hodotermitidae
1.5%
Cerambycidae
1.5%
Dytiscidae
1.5%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 2 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 3 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 13 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 16 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 17 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 18 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 28 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 38 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 39 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 40 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 43 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 46 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 47 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 55 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 57 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 58 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 59 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 62 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_188928 | 3300042656 | Bacteria | 1203 |
| 2 | Ga0123357_10472201 | 3300009784 | Bacteria | 1068 |
| 3 | Ga0123355_10435961 | 3300009826 | Unclassified | 1663 |
| 4 | Ga0123356_10063912 | 3300010049 | Bacteria | 3440 |
| 5 | Ga0123356_10193839 | 3300010049 | Bacteria | 2065 |
| 6 | Ga0123353_10000049 | 3300010167 | Bacteria | 131325 |
| 7 | Ga0123353_10385640 | 3300010167 | Bacteria | 2093 |
| 8 | Ga0123353_10523901 | 3300010167 | Bacteria | 1719 |
| 9 | Ga0123354_10078385 | 3300010882 | Bacteria | 4697 |
| 10 | Ga0466722_239506 | 3300042609 | Bacteria | 3782 |
| 11 | Ga0466712_124917 | 3300042614 | Bacteria | 16363 |
| 12 | Ga0466715_089915 | 3300042616 | Bacteria | 43716 |
| 13 | Ga0466723_321084 | 3300042618 | Bacteria | 2623 |
| 14 | Ga0466728_011518 | 3300042620 | Bacteria | 8454 |
| 15 | Ga0466703_117580 | 3300042636 | Bacteria | 35608 |
| 16 | Ga0466696_155696 | 3300042596 | Bacteria | 3049 |
| 17 | Ga0466697_066164 | 3300042611 | Bacteria | 3944 |
| 18 | Ga0123357_10041002 | 3300009784 | Bacteria | 6296 |
| 19 | Ga0123357_10240173 | 3300009784 | Bacteria | 1964 |
| 20 | Ga0123355_10000019 | 3300009826 | Bacteria | 155447 |
| 21 | Ga0123355_10234756 | 3300009826 | Bacteria | 2611 |
| 22 | Ga0123356_10231830 | 3300010049 | Bacteria | 1911 |
| 23 | Ga0123356_10512183 | 3300010049 | Bacteria | 1357 |
| 24 | Ga0466706_045532 | 3300042599 | Bacteria | 3808 |
| 25 | Ga0466707_395995 | 3300042601 | Bacteria | 2354 |
| 26 | Ga0466713_019666 | 3300042602 | Bacteria | 67660 |
| 27 | Ga0466716_269390 | 3300042605 | Bacteria | 7274 |
| 28 | Ga0466719_066860 | 3300042606 | Bacteria | 19321 |
| 29 | Ga0466705_399832 | 3300042612 | Bacteria | 4739 |
| 30 | Ga0466729_124520 | 3300042621 | Bacteria | 2352 |
| 31 | Ga0466704_144800 | 3300042643 | Bacteria | 19711 |
| 32 | Ga0264413_128986 | 3300024493 | Bacteria | 6564 |
| 33 | Ga0466690_260943 | 3300042590 | Bacteria | 1639 |
| 34 | Ga0466691_199275 | 3300042593 | Bacteria | 2320 |
| 35 | 2227108568 | 2225789004 | Bacteria | 39212 |
| 36 | JGI24702J35022_10015399 | 3300002462 | Bacteria | 4210 |
| 37 | Ga0123353_10028946 | 3300010167 | Bacteria | 8526 |
| 38 | Ga0123353_10070277 | 3300010167 | Unclassified | 5625 |
| 39 | Ga0123353_10164655 | 3300010167 | Bacteria | 3526 |
| 40 | Ga0466700_062180 | 3300042600 | Bacteria | 11765 |
| 41 | Ga0466727_091964 | 3300042655 | Bacteria | 2965 |
| 42 | Ga0466733_192122 | 3300042659 | Bacteria | 6070 |
| 43 | Ga0123355_10001043 | 3300009826 | Bacteria | 38382 |
| 44 | Ga0123353_10443371 | 3300010167 | Unclassified | 1914 |
| 45 | Ga0466719_364633 | 3300042606 | Bacteria | 1387 |
| 46 | Ga0466705_435278 | 3300042612 | Bacteria | 1072 |
| 47 | Ga0466711_465749 | 3300042615 | Bacteria | 10838 |
| 48 | Ga0466715_008622 | 3300042616 | Bacteria | 9831 |
| 49 | Ga0466715_034626 | 3300042616 | Bacteria | 2197 |
| 50 | Ga0466723_148153 | 3300042618 | Unclassified | 2063 |
| 51 | Ga0466702_066288 | 3300042635 | Bacteria | 2100 |
| 52 | Ga0466703_054491 | 3300042636 | Bacteria | 2070 |
| 53 | Ga0466704_048650 | 3300042643 | Unclassified | 18367 |
| 54 | Ga0466704_479714 | 3300042643 | Bacteria | 5602 |
| 55 | Ga0466709_352149 | 3300042648 | Bacteria | 153873 |
| 56 | Ga0466708_372741 | 3300042652 | Bacteria | 2851 |
| 57 | Ga0466727_284097 | 3300042655 | Bacteria | 24358 |
| 58 | Ga0123355_10000628 | 3300009826 | Bacteria | 47784 |
| 59 | Ga0123355_10083889 | 3300009826 | Unclassified | 5077 |
| 60 | Ga0123353_10008776 | 3300010167 | Bacteria | 13848 |
| 61 | Ga0123353_10026030 | 3300010167 | Unclassified | 8925 |
| 62 | Ga0123353_10196866 | 3300010167 | Bacteria | 3175 |
| 63 | Ga0123353_10206951 | 3300010167 | Bacteria | 3081 |
| 64 | Ga0123353_10626616 | 3300010167 | Bacteria | 1529 |
| 65 | Ga0123353_10818488 | 3300010167 | Bacteria | 1283 |
| 66 | Ga0466707_093312 | 3300042601 | Bacteria | 3896 |
| 67 | Ga0466707_205073 | 3300042601 | Bacteria | 53746 |
| 68 | Ga0466713_133121 | 3300042602 | Bacteria | 46740 |
| 69 | Ga0466711_292280 | 3300042615 | Bacteria | 2761 |
| 70 | Ga0466723_062833 | 3300042618 | Bacteria | 23048 |
| 71 | Ga0466726_070115 | 3300042619 | Bacteria | 6897 |
| 72 | Ga0466726_099866 | 3300042619 | Bacteria | 3210 |
| 73 | Ga0466728_245975 | 3300042620 | Bacteria | 3021 |
| 74 | Ga0466728_484564 | 3300042620 | Bacteria | 1978 |
| 75 | Ga0466735_207335 | 3300042624 | Bacteria | 2839 |
| 76 | Ga0466656_365506 | 3300042550 | Bacteria | 2520 |
| 77 | Ga0466697_226291 | 3300042611 | Bacteria | 1348 |
| 78 | Ga0466705_128995 | 3300042612 | Bacteria | 2148 |
| 79 | Ga0466733_052543 | 3300042659 | Bacteria | 2567 |
| 80 | Ga0068305_10009288 | 3300005083 | Unclassified | 6585 |
| 81 | Ga0074278_106802 | 3300005721 | Unclassified | 1995 |
| 82 | Ga0123357_10000075 | 3300009784 | Bacteria | 78678 |
| 83 | Ga0123355_10028504 | 3300009826 | Bacteria | 9028 |
| 84 | Ga0123354_10239382 | 3300010882 | Bacteria | 1872 |
| 85 | Ga0466713_099093 | 3300042602 | Bacteria | 8251 |
| 86 | Ga0466713_102403 | 3300042602 | Bacteria | 56108 |
| 87 | Ga0466713_131327 | 3300042602 | Bacteria | 7047 |
| 88 | Ga0466716_457707 | 3300042605 | Unclassified | 2671 |
| 89 | Ga0466719_249511 | 3300042606 | Bacteria | 22228 |
| 90 | Ga0466722_173348 | 3300042609 | Bacteria | 1005 |
| 91 | Ga0466711_194018 | 3300042615 | Bacteria | 2388 |
| 92 | Ga0466726_115727 | 3300042619 | Bacteria | 5099 |
| 93 | Ga0466728_246314 | 3300042620 | Bacteria | 2103 |
| 94 | Ga0466703_219620 | 3300042636 | Bacteria | 7749 |
| 95 | Ga0466704_298669 | 3300042643 | Bacteria | 6668 |
| 96 | Ga0466724_17703 | 3300042649 | Bacteria | 7055 |
| 97 | Ga0466691_199056 | 3300042593 | Bacteria | 4520 |
| 98 | Ga0466696_441932 | 3300042596 | Bacteria | 3567 |
| 99 | Ga0466697_091809 | 3300042611 | Bacteria | 1149 |
| 100 | Ga0466705_097553 | 3300042612 | Bacteria | 17096 |
| 101 | Ga0466705_279506 | 3300042612 | Bacteria | 7521 |
| 102 | Ga0466705_303497 | 3300042612 | Bacteria | 14374 |
| 103 | Ga0466732_057104 | 3300042656 | Bacteria | 2507 |
| 104 | Ga0123356_10005575 | 3300010049 | Bacteria | 12798 |
| 105 | Ga0123353_10204334 | 3300010167 | Bacteria | 3105 |
| 106 | Ga0123354_10000166 | 3300010882 | Bacteria | 53754 |
| 107 | Ga0123354_10138163 | 3300010882 | Bacteria | 3033 |
| 108 | Ga0466715_080954 | 3300042616 | Bacteria | 158723 |
| 109 | Ga0466723_070657 | 3300042618 | Unclassified | 3904 |
| 110 | Ga0466728_105369 | 3300042620 | Bacteria | 20110 |
| 111 | Ga0466702_001075 | 3300042635 | Bacteria | 4345 |
| 112 | Ga0466703_275384 | 3300042636 | Bacteria | 3875 |
| 113 | Ga0466704_163825 | 3300042643 | Bacteria | 2375 |
| 114 | Ga0466696_195034 | 3300042596 | Bacteria | 3799 |
| 115 | Ga0466733_016466 | 3300042659 | Bacteria | 11010 |
| 116 | AglaG_contig25748 | 2084038013 | Bacteria | 12359 |
| 117 | HBC_ctgsDRAFT_1023288 | 3300000333 | Bacteria | 1517 |
| 118 | JGI24705J35276_12237762 | 3300002504 | Bacteria | 12959 |
| 119 | Ga0123357_10052602 | 3300009784 | Bacteria | 5499 |
| 120 | Ga0123356_10005593 | 3300010049 | Bacteria | 12784 |
| 121 | Ga0123356_10054453 | 3300010049 | Bacteria | 3726 |
| 122 | Ga0123356_10059910 | 3300010049 | Bacteria | 3552 |
| 123 | Ga0123356_10362692 | 3300010049 | Bacteria | 1576 |
| 124 | Ga0123353_10000181 | 3300010167 | Bacteria | 80450 |
| 125 | Ga0123353_10423601 | 3300010167 | Bacteria | 1971 |
| 126 | Ga0466716_181544 | 3300042605 | Bacteria | 3820 |
| 127 | Ga0466705_434874 | 3300042612 | Bacteria | 13977 |
| 128 | Ga0466728_036972 | 3300042620 | Bacteria | 13453 |
| 129 | Ga0466728_356632 | 3300042620 | Unclassified | 6528 |
| 130 | Ga0466703_053569 | 3300042636 | Unclassified | 2072 |
| 131 | Ga0466690_279151 | 3300042590 | Unclassified | 1994 |
| 132 | Ga0466695_282062 | 3300042595 | Bacteria | 2206 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00535 | Glycos_transf_2 | Glycosyl transferase family 2 | 49 | 198 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.