Protein Family IF02541
Metagenome
Isolate
205
Members
46
Samples
191
Scaffolds
198.77
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10342078|Ga0123355_103420783
- Length
- 232 aa
- Sequence
- LIRDPLNRRSVWEIADQVRNDKIHTSKAGLGEIMNIHNVEFIKSAATSKDLIESPMPQIVFSGKSNVGKSSVINRLLNRKSFARVSSSPGKTIHVNYILVDKRAYFVDLPGYGYAKVAKTEKARWSKLMEDFFVQPDHITLGVMIVDARHKPTADDVIMSQWFKESGCNMIIVANKVDKLKNSEKERNLEVIRNTLNIHENTEIIMFSAEKGTNNDVLLARIKDSIANCRQ*
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Unclassified
32.6%
Kalotermitidae
17.4%
Passalidae
6.5%
Termopsidae
2.2%
Rhinotermitidae
2.2%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
1
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 3 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 8 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 11 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 12 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 28 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 29 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 45 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_369316 | 3300042612 | Bacteria | 39792 |
| 2 | Ga0466707_301506 | 3300042601 | Bacteria | 13680 |
| 3 | Ga0123356_10004908 | 3300010049 | Bacteria | 13728 |
| 4 | Ga0123356_10038422 | 3300010049 | Bacteria | 4460 |
| 5 | Ga0123356_10063688 | 3300010049 | Bacteria | 3446 |
| 6 | Ga0123356_10300174 | 3300010049 | Bacteria | 1711 |
| 7 | Ga0123356_10440418 | 3300010049 | Bacteria | 1449 |
| 8 | Ga0123356_10604784 | 3300010049 | Bacteria | 1261 |
| 9 | Ga0123356_11268951 | 3300010049 | Bacteria | 901 |
| 10 | Ga0123356_11977138 | 3300010049 | Bacteria | 727 |
| 11 | Ga0123353_10033149 | 3300010167 | Bacteria | 8035 |
| 12 | Ga0123353_10034336 | 3300010167 | Bacteria | 7914 |
| 13 | Ga0123353_10233009 | 3300010167 | Bacteria | 2869 |
| 14 | Ga0123353_10267619 | 3300010167 | Bacteria | 2635 |
| 15 | Ga0123353_10369077 | 3300010167 | Bacteria | 2153 |
| 16 | Ga0123353_10576527 | 3300010167 | Bacteria | 1615 |
| 17 | Ga0123353_10609313 | 3300010167 | Bacteria | 1558 |
| 18 | Ga0123353_10795115 | 3300010167 | Bacteria | 1307 |
| 19 | Ga0123353_10806314 | 3300010167 | Bacteria | 1295 |
| 20 | Ga0123353_10826584 | 3300010167 | Bacteria | 1274 |
| 21 | Ga0466715_068459 | 3300042616 | Bacteria | 61658 |
| 22 | Ga0466723_262892 | 3300042618 | Bacteria | 14258 |
| 23 | Ga0466728_114248 | 3300042620 | Bacteria | 4646 |
| 24 | 2227021498 | 2225789003 | Bacteria | 1017 |
| 25 | IMNBL1DRAFT_c0003186 | 3300000062 | Bacteria | 10742 |
| 26 | JGI24705J35276_12207732 | 3300002504 | Bacteria | 1753 |
| 27 | Ga0466707_156483 | 3300042601 | Bacteria | 5665 |
| 28 | Ga0466707_341485 | 3300042601 | Bacteria | 83714 |
| 29 | Ga0466699_066261 | 3300042597 | Bacteria | 1322 |
| 30 | Ga0123356_10011714 | 3300010049 | Bacteria | 8539 |
| 31 | Ga0123356_10020549 | 3300010049 | Bacteria | 6245 |
| 32 | Ga0123356_10142697 | 3300010049 | Bacteria | 2365 |
| 33 | Ga0123356_10144273 | 3300010049 | Bacteria | 2353 |
| 34 | Ga0123356_10156784 | 3300010049 | Bacteria | 2268 |
| 35 | Ga0123356_10319863 | 3300010049 | Bacteria | 1664 |
| 36 | Ga0123356_10710617 | 3300010049 | Viruses | 1174 |
| 37 | Ga0123356_11283403 | 3300010049 | Bacteria | 896 |
| 38 | Ga0123353_10002531 | 3300010167 | Bacteria | 22712 |
| 39 | Ga0123353_10065854 | 3300010167 | Bacteria | 5816 |
| 40 | Ga0123353_10137912 | 3300010167 | Bacteria | 3911 |
| 41 | Ga0123353_10281894 | 3300010167 | Bacteria | 2551 |
| 42 | Ga0123353_10346731 | 3300010167 | Bacteria | 2240 |
| 43 | Ga0123353_10890584 | 3300010167 | Bacteria | 1213 |
| 44 | Ga0123353_11261916 | 3300010167 | Bacteria | 963 |
| 45 | Ga0123354_10329219 | 3300010882 | Bacteria | 1395 |
| 46 | Ga0466725_194472 | 3300042654 | Bacteria | 3097 |
| 47 | 2227466379 | 2225789004 | Bacteria | 966 |
| 48 | JGI24695J34938_10000214 | 3300002450 | Bacteria | 55263 |
| 49 | Ga0466707_284440 | 3300042601 | Bacteria | 7431 |
| 50 | Ga0466721_386911 | 3300042608 | Bacteria | 7625 |
| 51 | Ga0415639_045275 | 3300038395 | Bacteria | 3570 |
| 52 | Ga0415639_067429 | 3300038395 | Bacteria | 2346 |
| 53 | Ga0123355_10000329 | 3300009826 | Bacteria | 61283 |
| 54 | Ga0123355_10342078 | 3300009826 | Bacteria | 1992 |
| 55 | Ga0123356_10000843 | 3300010049 | Bacteria | 34094 |
| 56 | Ga0123356_10089321 | 3300010049 | Bacteria | 2932 |
| 57 | Ga0123356_10102831 | 3300010049 | Bacteria | 2743 |
| 58 | Ga0123356_10178857 | 3300010049 | Unclassified | 2141 |
| 59 | Ga0123356_10209707 | 3300010049 | Bacteria | 1996 |
| 60 | Ga0123356_10396734 | 3300010049 | Bacteria | 1516 |
| 61 | Ga0123353_10063712 | 3300010167 | Bacteria | 5913 |
| 62 | Ga0123353_10106954 | 3300010167 | Bacteria | 4507 |
| 63 | Ga0123353_10123496 | 3300010167 | Bacteria | 4162 |
| 64 | Ga0123353_10199504 | 3300010167 | Bacteria | 3149 |
| 65 | Ga0123353_10409062 | 3300010167 | Bacteria | 2016 |
| 66 | Ga0123353_10436632 | 3300010167 | Bacteria | 1933 |
| 67 | Ga0123353_10453408 | 3300010167 | Bacteria | 1887 |
| 68 | Ga0123353_10761431 | 3300010167 | Bacteria | 1345 |
| 69 | Ga0123353_11380532 | 3300010167 | Bacteria | 907 |
| 70 | Ga0466726_387318 | 3300042619 | Bacteria | 3289 |
| 71 | 2227619059 | 2225789004 | Bacteria | 44942 |
| 72 | IMNBL1DRAFT_c0000130 | 3300000062 | Bacteria | 67390 |
| 73 | JGI24702J35022_10000992 | 3300002462 | Bacteria | 17790 |
| 74 | JGI24702J35022_10005572 | 3300002462 | Bacteria | 7343 |
| 75 | Ga0466707_189974 | 3300042601 | Bacteria | 31833 |
| 76 | Ga0466693_044368 | 3300042592 | Unclassified | 3413 |
| 77 | Ga0466696_321597 | 3300042596 | Bacteria | 24529 |
| 78 | Ga0123355_10000039 | 3300009826 | Bacteria | 127100 |
| 79 | Ga0123355_10131226 | 3300009826 | Bacteria | 3860 |
| 80 | Ga0123356_10000758 | 3300010049 | Bacteria | 35766 |
| 81 | Ga0123356_10009132 | 3300010049 | Bacteria | 9807 |
| 82 | Ga0123356_10123233 | 3300010049 | Bacteria | 2526 |
| 83 | Ga0123356_10691685 | 3300010049 | Bacteria | 1188 |
| 84 | Ga0123356_10997278 | 3300010049 | Bacteria | 1008 |
| 85 | Ga0123356_11030893 | 3300010049 | Bacteria | 992 |
| 86 | Ga0123353_10012293 | 3300010167 | Bacteria | 12154 |
| 87 | Ga0123353_10128379 | 3300010167 | Bacteria | 4071 |
| 88 | Ga0123353_10598048 | 3300010167 | Bacteria | 1577 |
| 89 | Ga0123353_10741733 | 3300010167 | Bacteria | 1369 |
| 90 | Ga0123353_11660082 | 3300010167 | Bacteria | 803 |
| 91 | Ga0466725_312257 | 3300042654 | Bacteria | 2825 |
| 92 | Ga0466723_105923 | 3300042618 | Bacteria | 51315 |
| 93 | IMNBL1DRAFT_c0005872 | 3300000062 | Bacteria | 6877 |
| 94 | Ga0466707_147414 | 3300042601 | Bacteria | 30829 |
| 95 | Ga0466714_013160 | 3300042603 | Bacteria | 4328 |
| 96 | Ga0466719_492463 | 3300042606 | Bacteria | 1676 |
| 97 | Ga0415639_045057 | 3300038395 | Bacteria | 4791 |
| 98 | Ga0466690_380947 | 3300042590 | Bacteria | 4574 |
| 99 | Ga0123357_10315377 | 3300009784 | Bacteria | 1554 |
| 100 | Ga0123355_10000092 | 3300009826 | Bacteria | 94509 |
| 101 | Ga0123356_10004131 | 3300010049 | Bacteria | 15072 |
| 102 | Ga0123356_10008088 | 3300010049 | Bacteria | 10472 |
| 103 | Ga0123356_10025128 | 3300010049 | Bacteria | 5601 |
| 104 | Ga0123356_10061477 | 3300010049 | Bacteria | 3508 |
| 105 | Ga0123356_10177285 | 3300010049 | Bacteria | 2149 |
| 106 | Ga0123356_10716095 | 3300010049 | Bacteria | 1170 |
| 107 | Ga0123356_10857535 | 3300010049 | Bacteria | 1079 |
| 108 | Ga0123353_10307698 | 3300010167 | Bacteria | 2414 |
| 109 | Ga0123353_10315319 | 3300010167 | Bacteria | 2377 |
| 110 | Ga0123353_10605948 | 3300010167 | Bacteria | 1564 |
| 111 | Ga0123353_10658097 | 3300010167 | Bacteria | 1481 |
| 112 | Ga0123353_11130642 | 3300010167 | Bacteria | 1036 |
| 113 | Ga0123354_10160553 | 3300010882 | Bacteria | 2671 |
| 114 | Ga0466725_341234 | 3300042654 | Bacteria | 1105 |
| 115 | IMNBL1DRAFT_c0003291 | 3300000062 | Bacteria | 10516 |
| 116 | IMNBL1DRAFT_c0053780 | 3300000062 | Bacteria | 1252 |
| 117 | Ga0068305_10038476 | 3300005083 | Bacteria | 58791 |
| 118 | Ga0466706_001644 | 3300042599 | Bacteria | 23740 |
| 119 | Ga0466706_287220 | 3300042599 | Bacteria | 76918 |
| 120 | Ga0466707_145670 | 3300042601 | Bacteria | 3661 |
| 121 | Ga0415639_114317 | 3300038395 | Bacteria | 1880 |
| 122 | Ga0123355_10464082 | 3300009826 | Bacteria | 1587 |
| 123 | Ga0123355_10696104 | 3300009826 | Bacteria | 1169 |
| 124 | Ga0123356_10017479 | 3300010049 | Bacteria | 6821 |
| 125 | Ga0123356_10038136 | 3300010049 | Bacteria | 4478 |
| 126 | Ga0123356_10060291 | 3300010049 | Bacteria | 3541 |
| 127 | Ga0123356_10134969 | 3300010049 | Bacteria | 2424 |
| 128 | Ga0123356_10203590 | 3300010049 | Bacteria | 2021 |
| 129 | Ga0123356_10556490 | 3300010049 | Bacteria | 1308 |
| 130 | Ga0123356_11125595 | 3300010049 | Bacteria | 953 |
| 131 | Ga0123356_11236841 | 3300010049 | Bacteria | 912 |
| 132 | Ga0123353_10000257 | 3300010167 | Bacteria | 67087 |
| 133 | Ga0123353_10110830 | 3300010167 | Bacteria | 4421 |
| 134 | Ga0123353_10140884 | 3300010167 | Bacteria | 3863 |
| 135 | Ga0123353_10463375 | 3300010167 | Bacteria | 1861 |
| 136 | Ga0123353_10477016 | 3300010167 | Bacteria | 1826 |
| 137 | Ga0123353_10492747 | 3300010167 | Bacteria | 1789 |
| 138 | Ga0123353_11277550 | 3300010167 | Bacteria | 955 |
| 139 | Ga0123353_11640674 | 3300010167 | Bacteria | 809 |
| 140 | Ga0123354_10270509 | 3300010882 | Bacteria | 1674 |
| 141 | Ga0466725_384334 | 3300042654 | Bacteria | 4091 |
| 142 | Ga0466726_378688 | 3300042619 | Bacteria | 9764 |
| 143 | IMNBL1DRAFT_c0009913 | 3300000062 | Bacteria | 4632 |
| 144 | JGI24695J34938_10015016 | 3300002450 | Bacteria | 3990 |
| 145 | JGI24702J35022_10012886 | 3300002462 | Bacteria | 4639 |
| 146 | JGI24705J35276_12196969 | 3300002504 | Bacteria | 1548 |
| 147 | Ga0466707_215495 | 3300042601 | Bacteria | 1238 |
| 148 | Ga0466707_354410 | 3300042601 | Bacteria | 6890 |
| 149 | Ga0466722_250574 | 3300042609 | Bacteria | 21383 |
| 150 | Ga0415639_103676 | 3300038395 | Bacteria | 1649 |
| 151 | Ga0466694_061768 | 3300042594 | Bacteria | 6360 |
| 152 | Ga0123355_10897518 | 3300009826 | Bacteria | 964 |
| 153 | Ga0123356_10002148 | 3300010049 | Bacteria | 21246 |
| 154 | Ga0123356_10002960 | 3300010049 | Bacteria | 17946 |
| 155 | Ga0123356_10011154 | 3300010049 | Bacteria | 8774 |
| 156 | Ga0123356_10012877 | 3300010049 | Bacteria | 8095 |
| 157 | Ga0123356_10087267 | 3300010049 | Bacteria | 2963 |
| 158 | Ga0123356_10097663 | 3300010049 | Bacteria | 2811 |
| 159 | Ga0123356_10242047 | 3300010049 | Bacteria | 1876 |
| 160 | Ga0123356_10373304 | 3300010049 | Bacteria | 1557 |
| 161 | Ga0123353_10038464 | 3300010167 | Bacteria | 7519 |
| 162 | Ga0123353_10211357 | 3300010167 | Bacteria | 3043 |
| 163 | Ga0123353_10810097 | 3300010167 | Bacteria | 1291 |
| 164 | Ga0123353_11380034 | 3300010167 | Bacteria | 908 |
| 165 | Ga0123354_10352937 | 3300010882 | Bacteria | 1308 |
| 166 | Ga0466718_071831 | 3300042617 | Bacteria | 1875 |
| 167 | JGI24702J35022_10000216 | 3300002462 | Bacteria | 32146 |
| 168 | Ga0466717_257857 | 3300042604 | Bacteria | 1246 |
| 169 | Ga0415639_005044 | 3300038395 | Bacteria | 7002 |
| 170 | Ga0123355_10019067 | 3300009826 | Bacteria | 10912 |
| 171 | Ga0123355_10057292 | 3300009826 | Bacteria | 6306 |
| 172 | Ga0123355_10239570 | 3300009826 | Bacteria | 2573 |
| 173 | Ga0123355_10378113 | 3300009826 | Bacteria | 1848 |
| 174 | Ga0123356_10000105 | 3300010049 | Bacteria | 88897 |
| 175 | Ga0123356_10000661 | 3300010049 | Bacteria | 37965 |
| 176 | Ga0123356_10001257 | 3300010049 | Bacteria | 28049 |
| 177 | Ga0123356_10008198 | 3300010049 | Bacteria | 10397 |
| 178 | Ga0123356_10025241 | 3300010049 | Bacteria | 5588 |
| 179 | Ga0123356_10026970 | 3300010049 | Bacteria | 5387 |
| 180 | Ga0123356_10137152 | 3300010049 | Unclassified | 2407 |
| 181 | Ga0123356_10810482 | 3300010049 | Bacteria | 1107 |
| 182 | Ga0123353_10009722 | 3300010167 | Bacteria | 13319 |
| 183 | Ga0123353_10120861 | 3300010167 | Bacteria | 4212 |
| 184 | Ga0123353_10218057 | 3300010167 | Bacteria | 2987 |
| 185 | Ga0123353_10478816 | 3300010167 | Bacteria | 1822 |
| 186 | Ga0466704_064350 | 3300042643 | Bacteria | 8281 |
| 187 | 2227619060 | 2225789004 | Bacteria | 44860 |
| 188 | JGI24695J34938_10000106 | 3300002450 | Bacteria | 73679 |
| 189 | JGI24695J34938_10102104 | 3300002450 | Bacteria | 1171 |
| 190 | JGI24702J35022_10200472 | 3300002462 | Bacteria | 1142 |
| 191 | JGI24702J35022_10330120 | 3300002462 | Bacteria | 907 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.