Protein Family IF02530

Metagenome Metatranscriptome Isolate
163 Members
68 Samples
116 Scaffolds
76.57 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10307120|Ga0123355_103071202
Length
81 aa
Sequence
MVKEIERHGIPVVHMCTVVPISLTVGANRIVPTVAIPYPLGDPNLPPAEEKELRRKLVRKALKALCTEVDEQTVFEDKKK*

📊 Sample Types

Isolate 28.8%
Metagenome 69.3%
MAG 0.0%
Metatranscriptome 1.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.2%
Termitidae 36.8%
Blattidae 14.7%
Passalidae 2.9%
Stratiomyidae 1.5%
Hodotermitidae 1.5%
Kalotermitidae 1.5%
Rhopalidae 1.5%
Formicidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
2 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
3 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
4 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
5 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
15 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
16 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
24 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
25 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
26 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
38 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
39 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
40 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
41 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
42 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
43 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
44 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
45 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
46 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
47 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
48 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
53 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
54 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
55 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
56 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
57 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
58 3300021192 Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA Metatranscriptome Termitidae
59 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
60 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
61 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
62 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
63 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
64 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
65 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
66 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
67 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_200631 3300042600 Bacteria 1346
2 Ga0123355_10000786 3300009826 Bacteria 43435
3 Ga0123355_10007536 3300009826 Bacteria 16330
4 Ga0123355_10053471 3300009826 Bacteria 6546
5 Ga0123355_10139873 3300009826 Bacteria 3707
6 Ga0123355_10317161 3300009826 Unclassified 2105
7 Ga0123355_10410302 3300009826 Bacteria 1739
8 Ga0123355_11048114 3300009826 Bacteria 857
9 Ga0123355_11143580 3300009826 Bacteria 803
10 Ga0123356_13526412 3300010049 Unclassified 542
11 Ga0123356_13982134 3300010049 Bacteria 509
12 Ga0123353_10934795 3300010167 Unclassified 1175
13 Ga0123353_12176727 3300010167 Bacteria 672
14 Ga0466733_050318 3300042659 Bacteria 7142
15 Ga0466693_064662 3300042592 Bacteria 5062
16 Ga0466717_168684 3300042604 Bacteria 2157
17 Ga0123355_10005491 3300009826 Bacteria 18585
18 Ga0123355_10097226 3300009826 Bacteria 4646
19 Ga0123355_10166761 3300009826 Bacteria 3303
20 Ga0123355_10187801 3300009826 Bacteria 3052
21 Ga0123355_10217120 3300009826 Bacteria 2758
22 Ga0123355_10565855 3300009826 Bacteria 1366
23 Ga0123355_10937300 3300009826 Bacteria 932
24 Ga0123353_10000037 3300010167 Bacteria 145591
25 Ga0123353_10537671 3300010167 Bacteria 1690
26 Ga0123354_10481772 3300010882 Bacteria 981
27 Ga0466724_39856 3300042649 Bacteria 27534
28 Ga0415639_133936 3300038395 Bacteria 2023
29 Ga0466695_338677 3300042595 Bacteria 2864
30 Ga0466707_409312 3300042601 Bacteria 4136
31 Ga0123355_10005875 3300009826 Bacteria 18071
32 Ga0123355_10128099 3300009826 Bacteria 3917
33 Ga0123355_10132474 3300009826 Bacteria 3837
34 Ga0123355_10560266 3300009826 Bacteria 1377
35 Ga0123355_10996140 3300009826 Bacteria 891
36 Ga0123356_10012502 3300010049 Bacteria 8231
37 Ga0123356_10100608 3300010049 Bacteria 2772
38 Ga0123356_13682219 3300010049 Bacteria 530
39 Ga0123353_10093911 3300010167 Bacteria 4833
40 Ga0123353_10114510 3300010167 Bacteria 4341
41 Ga0123353_10224508 3300010167 Bacteria 2934
42 JGI24700J35501_10921240 3300002508 Bacteria 4706
43 Ga0466711_149414 3300042615 Bacteria 12828
44 Ga0466706_179366 3300042599 Bacteria 2693
45 Ga0123355_10023652 3300009826 Unclassified 9869
46 Ga0123355_10219658 3300009826 Bacteria 2736
47 Ga0123355_10246674 3300009826 Bacteria 2521
48 Ga0123355_10290838 3300009826 Bacteria 2242
49 Ga0123355_10317286 3300009826 Unclassified 2104
50 Ga0123355_10794475 3300009826 Bacteria 1057
51 Ga0123355_10922125 3300009826 Bacteria 944
52 Ga0123355_11067739 3300009826 Unclassified 846
53 Ga0123355_11428445 3300009826 Bacteria 681
54 Ga0123355_11883602 3300009826 Bacteria 560
55 Ga0123356_13715033 3300010049 Bacteria 528
56 Ga0123353_10482427 3300010167 Bacteria 1813
57 Ga0123353_11304362 3300010167 Bacteria 942
58 JGI24698J34947_10090504 3300002449 Bacteria 1405
59 CVPL010L_1010365 3300002932 Bacteria 868
60 Ga0466710_093220 3300042613 Bacteria 1351
61 Ga0123355_10000142 3300009826 Bacteria 85673
62 Ga0123355_10513684 3300009826 Bacteria 1470
63 Ga0123355_10811839 3300009826 Bacteria 1040
64 Ga0123355_11264401 3300009826 Unclassified 745
65 Ga0123355_11580499 3300009826 Bacteria 633
66 Ga0123353_10795741 3300010167 Bacteria 1307
67 Ga0123354_10661855 3300010882 Unclassified 742
68 IMNBL1DRAFT_c0168534 3300000062 Bacteria 556
69 Ga0072940_1105194 3300005200 Bacteria 2442
70 Ga0466731_009151 3300042622 Bacteria 1740
71 Ga0466725_063175 3300042654 Bacteria 1585
72 Ga0466733_036420 3300042659 Bacteria 12541
73 Ga0415639_023011 3300038395 Bacteria 7396
74 Ga0466693_151258 3300042592 Bacteria 5707
75 Ga0123355_10253567 3300009826 Bacteria 2472
76 Ga0123355_10311939 3300009826 Bacteria 2130
77 Ga0123355_10373280 3300009826 Bacteria 1866
78 Ga0123355_11042628 3300009826 Bacteria 861
79 Ga0123356_11085806 3300010049 Bacteria 969
80 Ga0123356_12598391 3300010049 Bacteria 634
81 Ga0123353_11018444 3300010167 Bacteria 1110
82 Ga0123353_11851090 3300010167 Unclassified 747
83 Ga0123353_12331616 3300010167 Bacteria 642
84 2227414442 2225789004 Bacteria 1055
85 JGI24702J35022_10011032 3300002462 Bacteria 5037
86 Ga0466693_403917 3300042592 Bacteria 1082
87 Ga0123355_10178706 3300009826 Bacteria 3154
88 Ga0123355_10307120 3300009826 Bacteria 2155
89 Ga0123355_10652408 3300009826 Bacteria 1227
90 Ga0123355_11012666 3300009826 Unclassified 880
91 Ga0123356_11241894 3300010049 Bacteria 910
92 Ga0123353_10339623 3300010167 Bacteria 2269
93 Ga0123353_11092039 3300010167 Bacteria 1060
94 Ga0123353_11992736 3300010167 Bacteria 712
95 JGI24695J34938_10011087 3300002450 Bacteria 4881
96 JGI24695J34938_10083084 3300002450 Bacteria 1321
97 Ga0222432_1009276 3300021192 Bacteria 615
98 Ga0233288_1022424 3300022232 Bacteria 548
99 Ga0255809_1104598 3300022820 Bacteria 1722
100 Ga0466714_085078 3300042603 Bacteria 3460
101 Ga0466721_066099 3300042608 Bacteria 1669
102 Ga0123355_10000234 3300009826 Bacteria 70892
103 Ga0123355_10189046 3300009826 Bacteria 3038
104 Ga0123355_10530324 3300009826 Bacteria 1435
105 Ga0123355_10695441 3300009826 Bacteria 1169
106 Ga0123356_10138946 3300010049 Bacteria 2394
107 Ga0123356_11503316 3300010049 Bacteria 831
108 Ga0123353_10017084 3300010167 Bacteria 10641
109 Ga0123353_10218643 3300010167 Bacteria 2982
110 Ga0123353_10240350 3300010167 Bacteria 2814
111 Ga0123353_10928071 3300010167 Bacteria 1181
112 Ga0123353_11578432 3300010167 Bacteria 830
113 IMNBL1DRAFT_c0002568 3300000062 Bacteria 12508
114 JGI24695J34938_10617194 3300002450 Bacteria 506
115 JGI24703J35330_11748283 3300002501 Bacteria 13053
116 Ga0466725_087547 3300042654 Bacteria 6089

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.