Protein Family IF02520

Metagenome Metatranscriptome Isolate
193 Members
83 Samples
151 Scaffolds
213.33 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10268657|Ga0123355_102686571
Length
257 aa
Sequence
MKKAILAKKLGMSQIFAEDGKVIPVTVLEAGPCLVVHKKTIQKDGYSALQVGFEDVKEMKFKKAKDKSKLRVRMQDIKDTKNADEMANAAKANKKAKRLRVGNHLSRHRLKLFREKIGPDTLPKRYLRELRLDDCDQFEVGSEIKADFFTAGEFVDVSGTSKGKGFQGAIKRHGQHRGPLTHGSKYHRGLGSMGSGTTPGRVRKGKKMPGHMGAKAVTVQNLEVVRTDAEKNLILIRGAVPGVRGALVTIKSTVKM*

📊 Sample Types

Isolate 21.8%
Metagenome 76.7%
MAG 0.0%
Metatranscriptome 1.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.7%
Termitidae 25.6%
Apidae 15.9%
Kalotermitidae 7.3%
Termopsidae 3.7%
Rhinotermitidae 2.4%
Drosophilidae 2.4%
Tenebrionidae 2.4%
Passalidae 2.4%
Scarabaeidae 1.2%
Hodotermitidae 1.2%
Formicidae 1.2%
Culicidae 1.2%
Nymphalidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2920412021 Bombella sp. ESL0387 Isolate Apidae
2 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
3 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
4 2820316744 Unclassified Firmicutes Nt197P3bin99 Isolate Unclassified
5 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
6 2820098966 Unclassified Proteobacteria Lab288P1bin49 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
11 8074809037 Bombella apis MRM1 Isolate Apidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2834165886 Saccharibacter sp. M18 Isolate Apidae
14 2901819457 Bombella sp. ESL0385 Isolate Apidae
15 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
16 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
17 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
18 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
22 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
32 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
33 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
34 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
35 8074810961 Bombella apis SME1 Isolate Apidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
45 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
46 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
47 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2831736028 Parasaccharibacter apium A29 Isolate Apidae
50 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
51 2751185679 Parasaccharibacter apium G7_7_3c Isolate Apidae
52 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
53 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
54 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
55 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
56 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
57 8074812948 Bombella apis MRM1 Isolate Apidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
60 2834143536 Parasaccharibacter apium AS1 Isolate Apidae
61 2834160066 Parasaccharibacter apium B8 Isolate Apidae
62 2899194184 Bombella sp. ESL0378 Isolate Apidae
63 2920413932 Bombella sp. ESL0380 Isolate Apidae
64 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
65 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
66 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
67 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
68 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
69 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
70 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
71 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
72 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
73 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
74 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
75 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
76 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
77 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
78 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
79 2791354941 Bombella intestini R-52487 Isolate Unclassified
80 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
81 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
82 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
83 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_031543 3300042659 Bacteria 31583
2 Ga0123355_10000164 3300009826 Bacteria 81449
3 Ga0123355_10000459 3300009826 Bacteria 53637
4 Ga0123355_10001096 3300009826 Bacteria 37400
5 Ga0123355_10003105 3300009826 Bacteria 23706
6 Ga0123355_10033133 3300009826 Bacteria 8390
7 Ga0123355_10054682 3300009826 Unclassified 6468
8 Ga0123355_10108983 3300009826 Bacteria 4333
9 Ga0123355_10119593 3300009826 Bacteria 4090
10 Ga0123355_10175836 3300009826 Bacteria 3188
11 Ga0123355_10177831 3300009826 Bacteria 3165
12 Ga0123355_10234643 3300009826 Bacteria 2612
13 Ga0123355_10305485 3300009826 Bacteria 2163
14 Ga0123355_10348575 3300009826 Bacteria 1964
15 Ga0123355_10392257 3300009826 Bacteria 1798
16 Ga0123355_10559344 3300009826 Bacteria 1379
17 Ga0123355_10582572 3300009826 Bacteria 1337
18 Ga0123353_10050986 3300010167 Bacteria 6602
19 Ga0123353_10747250 3300010167 Bacteria 1362
20 Ga0415639_036660 3300038395 Bacteria 2428
21 Ga0466735_129358 3300042624 Bacteria 1087
22 Ga0466725_273211 3300042654 Bacteria 4127
23 Ga0466714_028900 3300042603 Bacteria 3621
24 Ga0466714_061865 3300042603 Bacteria 1492
25 Ga0466714_165470 3300042603 Unclassified 1106
26 Ga0466722_066025 3300042609 Bacteria 1310
27 JGI24703J35330_11392324 3300002501 Bacteria 950
28 Ga0466733_093556 3300042659 Bacteria 3713
29 Ga0562375_3375 3300056856 Unclassified 15179
30 Ga0123357_10251940 3300009784 Bacteria 1887
31 Ga0123355_10004431 3300009826 Bacteria 20424
32 Ga0123355_10050461 3300009826 Bacteria 6759
33 Ga0123355_10120010 3300009826 Bacteria 4082
34 Ga0123355_10232880 3300009826 Bacteria 2627
35 Ga0123355_10293931 3300009826 Bacteria 2225
36 Ga0123355_10321261 3300009826 Bacteria 2085
37 Ga0123355_10904491 3300009826 Bacteria 958
38 Ga0123355_10943375 3300009826 Bacteria 928
39 Ga0415639_079761 3300038395 Bacteria 5615
40 Ga0466693_280878 3300042592 Bacteria 2946
41 Ga0466729_287045 3300042621 Bacteria 99069
42 Ga0466714_087630 3300042603 Unclassified 1262
43 Ga0466733_184762 3300042659 Bacteria 1454
44 Ga0123355_10000469 3300009826 Bacteria 53443
45 Ga0123355_10001028 3300009826 Bacteria 38728
46 Ga0123355_10002864 3300009826 Bacteria 24503
47 Ga0123355_10049742 3300009826 Bacteria 6813
48 Ga0123355_10120787 3300009826 Bacteria 4066
49 Ga0123355_10603547 3300009826 Bacteria 1301
50 Ga0123355_10658012 3300009826 Bacteria 1220
51 Ga0415639_014045 3300038395 Bacteria 2863
52 Ga0466699_194279 3300042597 Bacteria 1829
53 Ga0466704_419482 3300042643 Bacteria 3689
54 Ga0466707_001979 3300042601 Bacteria 1704
55 Ga0466714_070441 3300042603 Bacteria 2254
56 Ga0466714_097899 3300042603 Unclassified 1389
57 Ga0466714_132127 3300042603 Bacteria 1322
58 Ga0466722_035400 3300042609 Bacteria 82053
59 JGI24700J35501_10928188 3300002508 Unclassified 7419
60 JGI24700J35501_10930659 3300002508 Bacteria 17918
61 Ga0103267_1003743 3300007190 Bacteria 4076
62 Ga0466726_338542 3300042619 Bacteria 30448
63 Ga0123355_10002719 3300009826 Bacteria 25071
64 Ga0123355_10020764 3300009826 Bacteria 10499
65 Ga0123355_10161208 3300009826 Bacteria 3379
66 Ga0123355_10216681 3300009826 Unclassified 2762
67 Ga0123355_10318303 3300009826 Bacteria 2100
68 Ga0123355_10435827 3300009826 Bacteria 1663
69 Ga0123353_10071905 3300010167 Bacteria 5559
70 Ga0466693_328236 3300042592 Bacteria 1148
71 Ga0466735_162760 3300042624 Bacteria 1313
72 Ga0466708_164450 3300042652 Bacteria 37163
73 Ga0466725_346621 3300042654 Bacteria 12162
74 Ga0466714_014318 3300042603 Bacteria 4955
75 Ga0466714_120550 3300042603 Unclassified 1176
76 Ga0466717_126542 3300042604 Bacteria 1595
77 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
78 JGI24695J34938_10030738 3300002450 Bacteria 2498
79 Ga0072941_1435504 3300005201 Bacteria 1674
80 Ga0466710_372236 3300042613 Bacteria 2546
81 Ga0466715_183088 3300042616 Bacteria 24090
82 Ga0466718_021244 3300042617 Bacteria 1059
83 Ga0562378_3285 3300056814 Bacteria 10270
84 Ga0123355_10000566 3300009826 Bacteria 49780
85 Ga0123355_10000635 3300009826 Bacteria 47525
86 Ga0123355_10001214 3300009826 Bacteria 35876
87 Ga0123355_10001831 3300009826 Bacteria 29750
88 Ga0123355_10157562 3300009826 Bacteria 3430
89 Ga0123355_10268657 3300009826 Bacteria 2374
90 Ga0123355_10437237 3300009826 Bacteria 1659
91 Ga0123355_10771605 3300009826 Bacteria 1081
92 Ga0123355_11314501 3300009826 Unclassified 724
93 Ga0466693_303524 3300042592 Bacteria 2098
94 Ga0466701_056390 3300042598 Bacteria 1787
95 Ga0466706_217860 3300042599 Bacteria 3241
96 Ga0466713_155303 3300042602 Bacteria 17735
97 Ga0466714_037088 3300042603 Bacteria 4629
98 Ga0466714_049595 3300042603 Bacteria 4027
99 2227507959 2225789004 Bacteria 65570
100 Meta3P_1002864 3300002464 Bacteria 2645
101 JGI24700J35501_10930310 3300002508 Bacteria 12898
102 Ga0466705_061344 3300042612 Bacteria 17468
103 Ga0123357_10141579 3300009784 Bacteria 2953
104 Ga0123355_10000168 3300009826 Bacteria 79476
105 Ga0123355_10005335 3300009826 Bacteria 18776
106 Ga0123355_10057266 3300009826 Bacteria 6307
107 Ga0123355_10193262 3300009826 Bacteria 2992
108 Ga0123355_10408795 3300009826 Bacteria 1744
109 Ga0123354_10478838 3300010882 Bacteria 986
110 Ga0223682_1001788 3300021231 Bacteria 1377
111 Ga0415639_037218 3300038395 Bacteria 1367
112 Ga0415639_064526 3300038395 Bacteria 3699
113 Ga0415639_191440 3300038395 Bacteria 3377
114 Ga0466693_384328 3300042592 Bacteria 2559
115 Ga0466724_03807 3300042649 Bacteria 3356
116 Ga0466714_149244 3300042603 Bacteria 1508
117 Ga0466714_155205 3300042603 Bacteria 1611
118 Ga0466719_203918 3300042606 Bacteria 15671
119 JGI24695J34938_10000025 3300002450 Bacteria 108086
120 Ga0123357_10316547 3300009784 Bacteria 1549
121 Ga0123355_10000555 3300009826 Bacteria 50033
122 Ga0123355_10000733 3300009826 Bacteria 44688
123 Ga0123355_10002085 3300009826 Bacteria 28219
124 Ga0123355_10002132 3300009826 Bacteria 27941
125 Ga0123355_10013785 3300009826 Bacteria 12596
126 Ga0123355_10184342 3300009826 Bacteria 3090
127 Ga0123355_10244079 3300009826 Bacteria 2539
128 Ga0123355_10520366 3300009826 Bacteria 1456
129 Ga0123355_10648279 3300009826 Bacteria 1233
130 Ga0123355_11002603 3300009826 Bacteria 886
131 Ga0123353_10344455 3300010167 Unclassified 2249
132 Ga0123353_11598756 3300010167 Bacteria 823
133 Ga0123354_10000033 3300010882 Bacteria 101764
134 Ga0223688_1018218 3300021227 Unclassified 1003
135 Ga0223688_1018219 3300021227 Bacteria 903
136 Ga0466693_113441 3300042592 Bacteria 28543
137 Ga0466707_406938 3300042601 Bacteria 47814
138 Ga0466714_051920 3300042603 Bacteria 2621
139 Ga0466714_065400 3300042603 Bacteria 2719
140 JGI24702J35022_10000691 3300002462 Bacteria 20609
141 JGI24702J35022_10051390 3300002462 Bacteria 2196
142 Ga0466710_017395 3300042613 Bacteria 26782
143 Ga0466723_136038 3300042618 Bacteria 1890
144 Ga0466726_377913 3300042619 Bacteria 1175
145 Ga0466733_003819 3300042659 Bacteria 23682
146 Ga0123355_10432820 3300009826 Bacteria 1672
147 Ga0123355_10682432 3300009826 Bacteria 1186
148 Ga0123355_10914776 3300009826 Bacteria 950
149 Ga0466693_017146 3300042592 Bacteria 2196
150 Ga0466704_448187 3300042643 Bacteria 10130
151 Ga0466727_154460 3300042655 Bacteria 2099

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 137 229 0.72

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.