Protein Family IF02505

Metagenome Isolate
183 Members
53 Samples
179 Scaffolds
417.92 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10241514|Ga0123355_102415142
Length
494 aa
Sequence
MTDQVVTVNGTRMRIYAAAYTSTNNWDIEPVHLALTNSQLLNSLGGSHCXXXXILEVNNMKIVYPVCCGVDVHKKFLVATIASTDKKGITQYVTETFVTLNRGLYNFCRWLADHNCYDVCMESTGKYWIPIFNILEQSNIRTTLTHPKFVRAIKGKKTDKKDSKWIADLFKHDLVPGSFIPPPNVRELRELARYRYKLVCMRSSEKNRYQDCMTISNIGLASVLSDPFGKTATDIMKRILSSEVFSDKDIEKLIRGTAKKKTDLILESIRDNRIETDQRFKMNEVSNHLDYLEQSILKTEVELYTRIAPYMHIVSHLANQLPGVTELSATLILAEIGFDMSVFESDKHLASWAGLAPSNDQSAGKKKSVRISKAGQFIKPLLVQVALSAIRSKKQPYFATKYQKLKARRGHKKAIIAIARMMLTCIYHMVLTGEVFNPSDLETTCKPAPKKQVFSDENVFAYLSAKGYDISTLTKISSSDESSAMGSSFGNSA*

📊 Sample Types

Isolate 2.2%
Metagenome 97.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.7%
Kalotermitidae 19.2%
Unclassified 9.6%
Termopsidae 7.7%
Passalidae 3.8%
Rhinotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
10 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
20 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
30 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
39 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
48 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
49 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
53 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_218466 3300042659 Bacteria 2267
2 Ga0466726_343592 3300042619 Bacteria 2322
3 Ga0466700_348381 3300042600 Bacteria 1863
4 Ga0466707_062075 3300042601 Bacteria 2486
5 Ga0466707_375150 3300042601 Bacteria 1649
6 Ga0466721_382504 3300042608 Bacteria 1666
7 Ga0466698_383090 3300042610 Bacteria 2106
8 Ga0123355_10046338 3300009826 Bacteria 7071
9 Ga0123355_10152276 3300009826 Bacteria 3510
10 Ga0123355_10446340 3300009826 Bacteria 1634
11 Ga0123355_10459046 3300009826 Bacteria 1600
12 Ga0123356_10231183 3300010049 Bacteria 1913
13 Ga0123353_10339607 3300010167 Bacteria 2269
14 Ga0123353_10340391 3300010167 Bacteria 2266
15 Ga0123354_10206398 3300010882 Bacteria 2140
16 2227203320 2225789004 Bacteria 1433
17 2227523526 2225789004 Bacteria 3291
18 IMNBL1DRAFT_c0039716 3300000062 Bacteria 1602
19 Ga0072941_1178624 3300005201 Bacteria 2580
20 Ga0466656_117120 3300042550 Bacteria 1828
21 Ga0466731_435667 3300042622 Bacteria 3418
22 Ga0466705_227314 3300042612 Bacteria 2687
23 Ga0466715_332688 3300042616 Bacteria 6582
24 Ga0466701_079804 3300042598 Bacteria 1869
25 Ga0466700_463365 3300042600 Bacteria 2580
26 Ga0466719_213262 3300042606 Bacteria 4087
27 Ga0466722_005438 3300042609 Bacteria 2178
28 Ga0466698_248406 3300042610 Bacteria 2209
29 Ga0123355_10010051 3300009826 Bacteria 14459
30 Ga0123353_10388256 3300010167 Bacteria 2084
31 Ga0123353_10462819 3300010167 Bacteria 1863
32 Ga0123353_10539716 3300010167 Bacteria 1686
33 Ga0123353_10570489 3300010167 Bacteria 1627
34 2227123871 2225789004 Bacteria 1688
35 AustNasuHG_c1006384 3300000089 Bacteria 4211
36 JGI24702J35022_10004818 3300002462 Bacteria 7975
37 JGI24696J40584_12944361 3300002834 Bacteria 1809
38 Ga0415639_011238 3300038395 Bacteria 2468
39 Ga0415639_039718 3300038395 Bacteria 1628
40 Ga0466694_095570 3300042594 Bacteria 1912
41 Ga0466696_368093 3300042596 Bacteria 1792
42 Ga0466734_036051 3300042623 Bacteria 1885
43 Ga0466724_18376 3300042649 Bacteria 2183
44 Ga0466708_029074 3300042652 Bacteria 1645
45 Ga0466711_325860 3300042615 Bacteria 2368
46 Ga0466707_128368 3300042601 Bacteria 1637
47 Ga0466714_072146 3300042603 Bacteria 1896
48 Ga0466717_131709 3300042604 Bacteria 7840
49 Ga0466719_258853 3300042606 Unclassified 2023
50 Ga0466721_003244 3300042608 Bacteria 1904
51 Ga0123357_10317984 3300009784 Unclassified 1542
52 Ga0123355_10518925 3300009826 Unclassified 1459
53 Ga0123356_10313912 3300010049 Bacteria 1678
54 Ga0123353_10216314 3300010167 Bacteria 3001
55 Ga0123353_10393623 3300010167 Bacteria 2066
56 2227630741 2225789004 Bacteria 2124
57 JGI24703J35330_11633068 3300002501 Bacteria 1505
58 JGI24696J40584_12929463 3300002834 Bacteria 1454
59 Ga0466693_060111 3300042592 Bacteria 2049
60 Ga0466705_185638 3300042612 Bacteria 1853
61 Ga0466705_382887 3300042612 Bacteria 2555
62 Ga0466733_084425 3300042659 Bacteria 5928
63 Ga0466733_138096 3300042659 Unclassified 2174
64 Ga0466715_365034 3300042616 Bacteria 3614
65 Ga0466700_049383 3300042600 Bacteria 1706
66 Ga0466700_187651 3300042600 Bacteria 2671
67 Ga0466721_201156 3300042608 Bacteria 1802
68 Ga0123355_10280666 3300009826 Unclassified 2300
69 Ga0123355_10349784 3300009826 Bacteria 1959
70 Ga0123356_10130592 3300010049 Bacteria 2460
71 Ga0123356_10215980 3300010049 Bacteria 1971
72 Ga0123356_10245815 3300010049 Bacteria 1863
73 Ga0123356_10254542 3300010049 Unclassified 1836
74 Ga0123356_10582096 3300010049 Bacteria 1283
75 Ga0123353_10332580 3300010167 Unclassified 2298
76 Ga0123353_10459451 3300010167 Bacteria 1871
77 Ga0123354_10173308 3300010882 Bacteria 2499
78 IMNBL1DRAFT_c0031757 3300000062 Bacteria 1915
79 JGI24702J35022_10056235 3300002462 Bacteria 2099
80 Ga0466656_015871 3300042550 Bacteria 2159
81 Ga0466656_075116 3300042550 Bacteria 1745
82 Ga0466657_160820 3300042582 Bacteria 2089
83 Ga0466694_162450 3300042594 Bacteria 2075
84 Ga0466734_014587 3300042623 Bacteria 2922
85 Ga0466704_143837 3300042643 Bacteria 1516
86 Ga0466709_053322 3300042648 Bacteria 44724
87 Ga0466725_325569 3300042654 Bacteria 1674
88 Ga0466697_255550 3300042611 Bacteria 2686
89 Ga0466710_107633 3300042613 Bacteria 1947
90 Ga0466710_367806 3300042613 Bacteria 2390
91 Ga0466700_091401 3300042600 Bacteria 1622
92 Ga0466714_014864 3300042603 Bacteria 1842
93 Ga0466716_418380 3300042605 Bacteria 2729
94 Ga0466719_339454 3300042606 Bacteria 2413
95 Ga0466721_230015 3300042608 Bacteria 1989
96 Ga0466698_244230 3300042610 Bacteria 1789
97 Ga0123355_10373182 3300009826 Bacteria 1866
98 Ga0123353_10372257 3300010167 Bacteria 2141
99 Ga0123353_10442452 3300010167 Bacteria 1917
100 Ga0123354_10156280 3300010882 Bacteria 2734
101 Ga0123354_10254349 3300010882 Unclassified 1771
102 IMNBL1DRAFT_c0033856 3300000062 Bacteria 1825
103 Ga0068302_10012373 3300005071 Bacteria 12098
104 Ga0072940_1212681 3300005200 Bacteria 2030
105 Ga0466693_409562 3300042592 Bacteria 2077
106 Ga0466702_416437 3300042635 Bacteria 1937
107 Ga0466703_304254 3300042636 Bacteria 4389
108 Ga0466704_340424 3300042643 Bacteria 7153
109 Ga0466709_056976 3300042648 Bacteria 1865
110 Ga0466725_194293 3300042654 Bacteria 1887
111 Ga0466725_298153 3300042654 Unclassified 2350
112 Ga0466733_016559 3300042659 Bacteria 21095
113 Ga0466722_114200 3300042609 Bacteria 2661
114 Ga0123357_10199955 3300009784 Bacteria 2277
115 Ga0123357_10297518 3300009784 Bacteria 1637
116 Ga0123355_10241514 3300009826 Bacteria 2558
117 Ga0123355_10335648 3300009826 Bacteria 2019
118 Ga0123355_10381951 3300009826 Bacteria 1834
119 Ga0123355_10383540 3300009826 Bacteria 1829
120 Ga0123356_10176337 3300010049 Bacteria 2154
121 Ga0123356_10178078 3300010049 Bacteria 2145
122 Ga0123356_10271593 3300010049 Bacteria 1786
123 Ga0123353_10433669 3300010167 Unclassified 1942
124 Ga0123353_10482030 3300010167 Bacteria 1814
125 Ga0123354_10257249 3300010882 Bacteria 1753
126 2227114733 2225789004 Bacteria 1727
127 IMNBL1DRAFT_c0036766 3300000062 Bacteria 1705
128 Ga0466734_158149 3300042623 Bacteria 1812
129 Ga0466703_116037 3300042636 Bacteria 2107
130 Ga0466703_288925 3300042636 Bacteria 1853
131 Ga0466725_124231 3300042654 Bacteria 2145
132 Ga0466705_066944 3300042612 Bacteria 1983
133 Ga0466733_003535 3300042659 Bacteria 1617
134 Ga0466715_230940 3300042616 Bacteria 7852
135 Ga0466726_442512 3300042619 Bacteria 2426
136 Ga0466700_090276 3300042600 Bacteria 1776
137 Ga0466700_458154 3300042600 Bacteria 2133
138 Ga0466700_490352 3300042600 Bacteria 1510
139 Ga0466714_016595 3300042603 Bacteria 2789
140 Ga0466716_415642 3300042605 Bacteria 1918
141 Ga0466722_035996 3300042609 Bacteria 1513
142 Ga0123355_10287185 3300009826 Bacteria 2262
143 Ga0123355_10409159 3300009826 Bacteria 1743
144 Ga0123355_10447952 3300009826 Bacteria 1629
145 Ga0123356_10248140 3300010049 Bacteria 1856
146 Ga0123356_10379134 3300010049 Bacteria 1546
147 Ga0123353_10218312 3300010167 Bacteria 2984
148 Ga0123353_10251048 3300010167 Bacteria 2740
149 Ga0123353_10342137 3300010167 Bacteria 2259
150 Ga0123353_10371125 3300010167 Bacteria 2145
151 Ga0123353_10494626 3300010167 Unclassified 1784
152 Ga0123353_10551566 3300010167 Bacteria 1662
153 Ga0123353_10628717 3300010167 Bacteria 1526
154 Ga0123354_10199933 3300010882 Bacteria 2201
155 JGI24702J35022_10094486 3300002462 Bacteria 1630
156 Ga0466656_269078 3300042550 Bacteria 1884
157 Ga0466657_026214 3300042582 Bacteria 1918
158 Ga0466693_168684 3300042592 Bacteria 2294
159 Ga0466734_001975 3300042623 Bacteria 1394
160 Ga0466734_172122 3300042623 Unclassified 2001
161 Ga0466727_109168 3300042655 Bacteria 7653
162 Ga0466697_111143 3300042611 Bacteria 1606
163 Ga0466726_350678 3300042619 Bacteria 1754
164 Ga0466700_040886 3300042600 Unclassified 1948
165 Ga0466700_127031 3300042600 Bacteria 1727
166 Ga0466700_458145 3300042600 Bacteria 1600
167 Ga0123357_10109636 3300009784 Bacteria 3526
168 Ga0123356_10226048 3300010049 Bacteria 1932
169 Ga0123353_10274129 3300010167 Bacteria 2597
170 Ga0123353_10535615 3300010167 Bacteria 1694
171 Ga0123353_10652574 3300010167 Bacteria 1489
172 IMNBL1DRAFT_c0024334 3300000062 Bacteria 2350
173 JGI24705J35276_12214856 3300002504 Bacteria 1978
174 Ga0466693_307466 3300042592 Bacteria 2785
175 Ga0466735_203886 3300042624 Bacteria 1876
176 Ga0466703_206725 3300042636 Bacteria 1687
177 Ga0466703_233224 3300042636 Bacteria 2093
178 Ga0466704_035754 3300042643 Bacteria 3035
179 Ga0466704_079387 3300042643 Unclassified 1531

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10494626 Ga0123353_104946261 348
2 3300042611 Ga0466697_111143 Ga0466697_111143_77_1123 348
3 3300042600 Ga0466700_091401 Ga0466700_091401_420_1475 351
4 3300005071 Ga0068302_10012373 Ga0068302_100123739 356
5 2225789004 2227114733 2227505185 361
6 3300002504 JGI24705J35276_12214856 JGI24705J35276_122148561 362
7 iso_pr_bacteria 2820785563 2820786953 389
8 3300042600 Ga0466700_049383 Ga0466700_049383_100_1278 392
9 3300042608 Ga0466721_382504 Ga0466721_382504_404_1582 392
10 3300009826 Ga0123355_10046338 Ga0123355_100463383 393
11 3300010049 Ga0123356_10248140 Ga0123356_102481402 393
12 3300042659 Ga0466733_138096 Ga0466733_138096_550_1782 394
13 3300042659 Ga0466733_003535 Ga0466733_003535_295_1527 396
14 3300009826 Ga0123355_10373182 Ga0123355_103731821 398
15 3300042596 Ga0466696_368093 Ga0466696_368093_162_1358 398
16 3300042609 Ga0466722_035996 Ga0466722_035996_220_1416 398
17 3300042603 Ga0466714_072146 Ga0466714_072146_185_1390 401
18 3300042636 Ga0466703_116037 Ga0466703_116037_592_1797 401
19 3300042550 Ga0466656_269078 Ga0466656_269078_224_1438 404
20 3300010167 Ga0123353_10551566 Ga0123353_105515661 405
21 3300042594 Ga0466694_162450 Ga0466694_162450_342_1562 406
22 3300042603 Ga0466714_014864 Ga0466714_014864_145_1365 406
23 3300010049 Ga0123356_10254542 Ga0123356_102545421 407
24 3300010049 Ga0123356_10582096 Ga0123356_105820961 409
25 2225789004 2227123871 2227517999 410
26 3300010049 Ga0123356_10271593 Ga0123356_102715931 410
27 3300038395 Ga0415639_039718 Ga0415639_039718_90_1322 410
28 3300042601 Ga0466707_128368 Ga0466707_128368_316_1548 410
29 3300042608 Ga0466721_230015 Ga0466721_230015_97_1329 410
30 3300042610 Ga0466698_244230 Ga0466698_244230_441_1673 410
31 3300042622 Ga0466731_435667 Ga0466731_435667_1451_2683 410
32 3300042623 Ga0466734_001975 Ga0466734_001975_114_1346 410
33 3300042623 Ga0466734_014587 Ga0466734_014587_580_1812 410
34 3300042636 Ga0466703_206725 Ga0466703_206725_213_1445 410
35 3300042648 Ga0466709_053322 Ga0466709_053322_10871_12103 410
36 3300042654 Ga0466725_124231 Ga0466725_124231_275_1507 410
37 3300042654 Ga0466725_194293 Ga0466725_194293_468_1700 410
38 3300042659 Ga0466733_218466 Ga0466733_218466_100_1332 410
39 iso_pr_bacteria 2820639607 2820640844 410
40 2225789004 2227203320 2227629766 411
41 3300000062 IMNBL1DRAFT_c0031757 IMNBL1DRAFT_00317572 411
42 3300000062 IMNBL1DRAFT_c0033856 IMNBL1DRAFT_00338561 411
43 3300002462 JGI24702J35022_10094486 JGI24702J35022_100944861 411
44 3300009784 Ga0123357_10297518 Ga0123357_102975182 411
45 3300009826 Ga0123355_10381951 Ga0123355_103819512 411
46 3300010049 Ga0123356_10130592 Ga0123356_101305922 411
47 3300010049 Ga0123356_10215980 Ga0123356_102159802 411
48 3300010049 Ga0123356_10245815 Ga0123356_102458151 411
49 3300010167 Ga0123353_10371125 Ga0123353_103711252 411
50 3300010167 Ga0123353_10393623 Ga0123353_103936232 411
51 3300010167 Ga0123353_10482030 Ga0123353_104820302 411
52 3300010167 Ga0123353_10570489 Ga0123353_105704891 411
53 3300010167 Ga0123353_10628717 Ga0123353_106287172 411
54 3300042550 Ga0466656_075116 Ga0466656_075116_373_1608 411
55 3300042600 Ga0466700_458145 Ga0466700_458145_118_1353 411
56 3300042605 Ga0466716_415642 Ga0466716_415642_319_1554 411
57 3300042606 Ga0466719_213262 Ga0466719_213262_522_1757 411
58 3300042609 Ga0466722_114200 Ga0466722_114200_577_1812 411
59 iso_pr_bacteria 2820229114 2820229415 411
60 3300002462 JGI24702J35022_10004818 JGI24702J35022_100048182 412
61 3300009826 Ga0123355_10446340 Ga0123355_104463401 412
62 3300010167 Ga0123353_10216314 Ga0123353_102163142 412
63 3300010167 Ga0123353_10218312 Ga0123353_102183121 412
64 3300010167 Ga0123353_10274129 Ga0123353_102741292 412
65 3300010167 Ga0123353_10332580 Ga0123353_103325802 412
66 3300010167 Ga0123353_10342137 Ga0123353_103421373 412
67 3300010167 Ga0123353_10459451 Ga0123353_104594512 412
68 3300010167 Ga0123353_10539716 Ga0123353_105397161 412
69 3300010882 Ga0123354_10173308 Ga0123354_101733083 412
70 3300042610 Ga0466698_248406 Ga0466698_248406_441_1679 412
71 3300010167 Ga0123353_10372257 Ga0123353_103722572 413
72 3300042610 Ga0466698_383090 Ga0466698_383090_625_1866 413
73 3300042612 Ga0466705_066944 Ga0466705_066944_645_1886 413
74 3300042612 Ga0466705_382887 Ga0466705_382887_878_2119 413
75 3300042619 Ga0466726_343592 Ga0466726_343592_673_1914 413
76 3300042635 Ga0466702_416437 Ga0466702_416437_195_1436 413
77 3300002501 JGI24703J35330_11633068 JGI24703J35330_116330681 414
78 3300010167 Ga0123353_10535615 Ga0123353_105356151 414
79 3300010882 Ga0123354_10206398 Ga0123354_102063981 414
80 3300042606 Ga0466719_339454 Ga0466719_339454_963_2207 414
81 3300042619 Ga0466726_442512 Ga0466726_442512_90_1334 414
82 3300000062 IMNBL1DRAFT_c0039716 IMNBL1DRAFT_00397161 415
83 3300042600 Ga0466700_463365 Ga0466700_463365_559_1851 415
84 3300042615 Ga0466711_325860 Ga0466711_325860_783_2030 415
85 3300000062 IMNBL1DRAFT_c0036766 IMNBL1DRAFT_00367662 416
86 3300002834 JGI24696J40584_12929463 JGI24696J40584_129294631 416
87 3300010167 Ga0123353_10388256 Ga0123353_103882561 416
88 3300042608 Ga0466721_003244 Ga0466721_003244_175_1425 416
89 3300042616 Ga0466715_365034 Ga0466715_365034_311_1561 416
90 3300042636 Ga0466703_288925 Ga0466703_288925_48_1298 416
91 3300042643 Ga0466704_035754 Ga0466704_035754_95_1345 416
92 3300042643 Ga0466704_143837 Ga0466704_143837_132_1382 416
93 3300042648 Ga0466709_056976 Ga0466709_056976_199_1449 416
94 3300042652 Ga0466708_029074 Ga0466708_029074_298_1548 416
95 3300042655 Ga0466727_109168 Ga0466727_109168_3455_4705 416
96 3300002462 JGI24702J35022_10056235 JGI24702J35022_100562352 417
97 3300010167 Ga0123353_10251048 Ga0123353_102510482 417
98 3300010167 Ga0123353_10652574 Ga0123353_106525741 417
99 3300010882 Ga0123354_10257249 Ga0123354_102572491 417
100 3300042600 Ga0466700_127031 Ga0466700_127031_123_1376 417
101 3300042643 Ga0466704_340424 Ga0466704_340424_3021_4274 417
102 3300042649 Ga0466724_18376 Ga0466724_18376_627_1904 417
103 iso_pr_bacteria 2820324456 2820326321 417
104 3300042582 Ga0466657_026214 Ga0466657_026214_326_1582 418
105 3300042600 Ga0466700_348381 Ga0466700_348381_237_1493 418
106 3300042612 Ga0466705_227314 Ga0466705_227314_997_2253 418
107 3300042616 Ga0466715_230940 Ga0466715_230940_3831_5087 418
108 3300009826 Ga0123355_10010051 Ga0123355_100100518 419
109 3300009826 Ga0123355_10409159 Ga0123355_104091592 419
110 3300009826 Ga0123355_10447952 Ga0123355_104479521 419
111 3300009826 Ga0123355_10518925 Ga0123355_105189251 419
112 3300010049 Ga0123356_10176337 Ga0123356_101763372 419
113 3300042592 Ga0466693_060111 Ga0466693_060111_433_1692 419
114 3300042592 Ga0466693_307466 Ga0466693_307466_25_1284 419
115 3300042592 Ga0466693_409562 Ga0466693_409562_569_1828 419
116 3300042598 Ga0466701_079804 Ga0466701_079804_233_1492 419
117 3300042604 Ga0466717_131709 Ga0466717_131709_1861_3120 419
118 3300042605 Ga0466716_418380 Ga0466716_418380_1118_2377 419
119 3300042613 Ga0466710_107633 Ga0466710_107633_313_1572 419
120 3300000062 IMNBL1DRAFT_c0024334 IMNBL1DRAFT_00243342 420
121 3300009784 Ga0123357_10199955 Ga0123357_101999552 420
122 3300009826 Ga0123355_10280666 Ga0123355_102806661 420
123 3300009826 Ga0123355_10287185 Ga0123355_102871852 420
124 3300009826 Ga0123355_10459046 Ga0123355_104590461 420
125 3300010049 Ga0123356_10313912 Ga0123356_103139122 420
126 3300010049 Ga0123356_10379134 Ga0123356_103791341 420
127 3300010167 Ga0123353_10433669 Ga0123353_104336691 420
128 3300010167 Ga0123353_10442452 Ga0123353_104424521 420
129 3300010882 Ga0123354_10199933 Ga0123354_101999333 420
130 3300042550 Ga0466656_117120 Ga0466656_117120_109_1401 420
131 3300042582 Ga0466657_160820 Ga0466657_160820_216_1478 420
132 3300042600 Ga0466700_490352 Ga0466700_490352_73_1335 420
133 3300009784 Ga0123357_10317984 Ga0123357_103179841 421
134 3300010167 Ga0123353_10339607 Ga0123353_103396072 421
135 3300042600 Ga0466700_187651 Ga0466700_187651_401_1669 422
136 3300042643 Ga0466704_079387 Ga0466704_079387_15_1283 422
137 2225789004 2227523526 2228029124 423
138 2225789004 2227630741 2228214798 423
139 3300010049 Ga0123356_10231183 Ga0123356_102311831 423
140 3300010882 Ga0123354_10254349 Ga0123354_102543491 423
141 3300042616 Ga0466715_332688 Ga0466715_332688_5013_6284 423
142 3300042623 Ga0466734_158149 Ga0466734_158149_370_1641 423
143 3300042600 Ga0466700_090276 Ga0466700_090276_82_1356 424
144 3300042613 Ga0466710_367806 Ga0466710_367806_178_1452 424
145 3300009784 Ga0123357_10109636 Ga0123357_101096362 425
146 3300010049 Ga0123356_10226048 Ga0123356_102260482 425
147 3300042550 Ga0466656_015871 Ga0466656_015871_439_1716 425
148 3300042594 Ga0466694_095570 Ga0466694_095570_547_1824 425
149 3300042592 Ga0466693_168684 Ga0466693_168684_532_1812 426
150 3300005200 Ga0072940_1212681 Ga0072940_12126811 428
151 3300005201 Ga0072941_1178624 Ga0072941_11786242 428
152 3300010882 Ga0123354_10156280 Ga0123354_101562803 428
153 3300000089 AustNasuHG_c1006384 AustNasuHG_10063843 430
154 3300042606 Ga0466719_258853 Ga0466719_258853_101_1402 433
155 3300042612 Ga0466705_185638 Ga0466705_185638_251_1552 433
156 3300042611 Ga0466697_255550 Ga0466697_255550_559_1863 434
157 3300009826 Ga0123355_10335648 Ga0123355_103356481 435
158 3300042600 Ga0466700_040886 Ga0466700_040886_191_1498 435
159 3300042600 Ga0466700_458154 Ga0466700_458154_451_1758 435
160 3300042623 Ga0466734_172122 Ga0466734_172122_434_1741 435
161 3300009826 Ga0123355_10383540 Ga0123355_103835401 436
162 3300042654 Ga0466725_298153 Ga0466725_298153_640_1953 437
163 3300010167 Ga0123353_10340391 Ga0123353_103403912 438
164 3300042609 Ga0466722_005438 Ga0466722_005438_483_1802 439
165 3300042624 Ga0466735_203886 Ga0466735_203886_303_1631 442
166 3300042636 Ga0466703_304254 Ga0466703_304254_2162_3490 442
167 3300009826 Ga0123355_10349784 Ga0123355_103497841 443
168 3300042659 Ga0466733_016559 Ga0466733_016559_230_1564 444
169 3300042601 Ga0466707_062075 Ga0466707_062075_236_1573 445
170 3300010049 Ga0123356_10178078 Ga0123356_101780782 446
171 3300009826 Ga0123355_10152276 Ga0123355_101522764 448
172 3300042619 Ga0466726_350678 Ga0466726_350678_208_1560 450
173 3300042608 Ga0466721_201156 Ga0466721_201156_172_1536 454
174 3300042654 Ga0466725_325569 Ga0466725_325569_56_1420 454
175 3300042623 Ga0466734_036051 Ga0466734_036051_413_1786 457
176 3300042659 Ga0466733_084425 Ga0466733_084425_3430_4806 458
177 3300042601 Ga0466707_375150 Ga0466707_375150_164_1552 462
178 3300042636 Ga0466703_233224 Ga0466703_233224_426_1817 463
179 3300042603 Ga0466714_016595 Ga0466714_016595_727_2121 464
180 3300010167 Ga0123353_10462819 Ga0123353_104628191 472
181 3300038395 Ga0415639_011238 Ga0415639_011238_924_2372 482
182 3300002834 JGI24696J40584_12944361 JGI24696J40584_129443612 483
183 3300009826 Ga0123355_10241514 Ga0123355_102415142 494

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02371 Transposase_20 Transposase IS116/IS110/IS902 family 316 403 0.92
PF01548 DEDD_Tnp_IS110 Transposase 68 214 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.