Protein Family IF02496

Metagenome Metatranscriptome Isolate
195 Members
75 Samples
159 Scaffolds
97.62 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10222713|Ga0123355_102227132
Length
120 aa
Sequence
VRNYWRGSLCPKSSKLTKGVIAVVLEINLEFFAHKKGVGSTKNGRDSNAKRLGAKRADGQFVLAGNILFTQRGTKIHPGNNVGRGSNDNLFALVDGTVRFERKGRDKKQVSVYPVAAQA*

📊 Sample Types

Isolate 18.5%
Metagenome 78.5%
MAG 0.0%
Metatranscriptome 3.1%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.3%
Termitidae 35.1%
Kalotermitidae 6.8%
Termopsidae 4.1%
Passalidae 2.7%
Stratiomyidae 1.4%
Hodotermitidae 1.4%
Rhinotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
2 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
3 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
8 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
9 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
19 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
20 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
21 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
22 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
23 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
24 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
25 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
31 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
32 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
33 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
34 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
35 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
36 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
37 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300021240 Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA Metatranscriptome Termitidae
42 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
43 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
44 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
50 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
51 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
52 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
53 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
54 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
61 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
62 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
63 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
68 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
69 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
70 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
71 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
72 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
73 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
74 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
75 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_121581 3300042612 Bacteria 83604
2 Ga0123355_10000544 3300009826 Bacteria 50570
3 Ga0123355_10009827 3300009826 Unclassified 14604
4 Ga0123355_10021167 3300009826 Bacteria 10405
5 Ga0123355_10308135 3300009826 Unclassified 2150
6 Ga0123355_10389615 3300009826 Bacteria 1807
7 Ga0123355_10630564 3300009826 Bacteria 1259
8 Ga0123355_10656947 3300009826 Unclassified 1221
9 Ga0123355_10913720 3300009826 Bacteria 951
10 Ga0123355_11044807 3300009826 Bacteria 859
11 Ga0123355_11230031 3300009826 Bacteria 760
12 Ga0123355_11633657 3300009826 Unclassified 618
13 Ga0123353_10090766 3300010167 Bacteria 4920
14 Ga0123353_10542566 3300010167 Bacteria 1680
15 Ga0123354_10239212 3300010882 Bacteria 1873
16 Ga0222431_1018325 3300021190 Bacteria 531
17 Ga0415639_035794 3300038395 Bacteria 4821
18 Ga0415639_113263 3300038395 Unclassified 4014
19 Ga0466722_190003 3300042609 Bacteria 6720
20 Ga0466715_642552 3300042616 Bacteria 1234
21 Ga0123357_10077230 3300009784 Bacteria 4394
22 Ga0123355_10000001 3300009826 Bacteria 286680
23 Ga0123355_10000641 3300009826 Bacteria 47393
24 Ga0123355_10003004 3300009826 Bacteria 24024
25 Ga0123355_10009343 3300009826 Bacteria 14894
26 Ga0123355_10052355 3300009826 Unclassified 6623
27 Ga0123355_10191707 3300009826 Bacteria 3009
28 Ga0123355_10222713 3300009826 Bacteria 2710
29 Ga0123355_10302949 3300009826 Bacteria 2176
30 Ga0123355_10582078 3300009826 Bacteria 1337
31 Ga0123355_10717981 3300009826 Bacteria 1141
32 Ga0123355_11175678 3300009826 Bacteria 787
33 Ga0123356_10110436 3300010049 Bacteria 2655
34 Ga0123353_10184001 3300010167 Bacteria 3305
35 Ga0223684_1012445 3300021240 Bacteria 806
36 JGI24702J35022_10163687 3300002462 Bacteria 1254
37 JGI24700J35501_10930398 3300002508 Bacteria 13612
38 JGI24700J35501_10930933 3300002508 Bacteria 64079
39 Ga0466714_026375 3300042603 Bacteria 121146
40 Ga0466714_028113 3300042603 Bacteria 1009
41 Ga0466716_479413 3300042605 Bacteria 2122
42 Ga0466697_157788 3300042611 Bacteria 1382
43 Ga0466735_041566 3300042624 Unclassified 1780
44 Ga0466725_241997 3300042654 Bacteria 18238
45 Ga0123357_10348823 3300009784 Unclassified 1419
46 Ga0123357_10899529 3300009784 Bacteria 572
47 Ga0123355_10001053 3300009826 Bacteria 38219
48 Ga0123355_10057937 3300009826 Bacteria 6269
49 Ga0123355_10113911 3300009826 Bacteria 4217
50 Ga0123355_10197798 3300009826 Bacteria 2944
51 Ga0123355_10546535 3300009826 Bacteria 1403
52 Ga0123355_10676566 3300009826 Unclassified 1194
53 Ga0123355_10740212 3300009826 Bacteria 1115
54 Ga0123353_10000039 3300010167 Bacteria 140682
55 Ga0123353_10241081 3300010167 Bacteria 2809
56 Ga0123353_12482998 3300010167 Bacteria 617
57 2227516885 2225789004 Bacteria 3422
58 IMNBL1DRAFT_c0002352 3300000062 Bacteria 13226
59 IMNBL1DRAFT_c0003103 3300000062 Bacteria 10960
60 Ga0068305_10026646 3300005083 Bacteria 11113
61 Ga0466714_045686 3300042603 Bacteria 12124
62 Ga0466725_193647 3300042654 Unclassified 3768
63 Ga0466725_415998 3300042654 Bacteria 1421
64 Ga0466715_288668 3300042616 Bacteria 8925
65 Ga0123355_10053913 3300009826 Bacteria 6517
66 Ga0123355_10195485 3300009826 Bacteria 2968
67 Ga0123355_10211451 3300009826 Unclassified 2810
68 Ga0123355_10255248 3300009826 Bacteria 2461
69 Ga0123355_10563673 3300009826 Bacteria 1370
70 Ga0123355_10602345 3300009826 Bacteria 1303
71 Ga0123355_11152533 3300009826 Bacteria 798
72 Ga0123354_10084413 3300010882 Bacteria 4459
73 Ga0123354_10566657 3300010882 Bacteria 848
74 Ga0466693_245591 3300042592 Bacteria 1405
75 JGI24703J35330_11719296 3300002501 Bacteria 2348
76 Ga0466700_326995 3300042600 Bacteria 1208
77 Ga0466717_203436 3300042604 Bacteria 6077
78 Ga0466734_048189 3300042623 Bacteria 1214
79 Ga0123357_10129562 3300009784 Bacteria 3147
80 Ga0123357_10437959 3300009784 Bacteria 1147
81 Ga0123355_10008215 3300009826 Bacteria 15765
82 Ga0123355_10011911 3300009826 Bacteria 13440
83 Ga0123355_10173323 3300009826 Bacteria 3219
84 Ga0123355_10454597 3300009826 Bacteria 1611
85 Ga0123353_10143669 3300010167 Bacteria 3819
86 Ga0123353_10659936 3300010167 Bacteria 1478
87 Ga0223686_1033786 3300021244 Bacteria 1185
88 Ga0255808_1056872 3300023282 Bacteria 645
89 Ga0415639_020307 3300038395 Bacteria 21634
90 IMNBL1DRAFT_c0036365 3300000062 Unclassified 1721
91 Ga0466706_159931 3300042599 Bacteria 3443
92 Ga0466719_199938 3300042606 Bacteria 48502
93 Ga0466733_012891 3300042659 Bacteria 3840
94 Ga0466727_257032 3300042655 Bacteria 2564
95 Ga0466705_452703 3300042612 Bacteria 11648
96 Ga0466715_036961 3300042616 Bacteria 59596
97 Ga0123357_10346509 3300009784 Bacteria 1428
98 Ga0123355_10000025 3300009826 Bacteria 148009
99 Ga0123355_10001317 3300009826 Bacteria 34637
100 Ga0123355_10017840 3300009826 Bacteria 11229
101 Ga0123355_10018787 3300009826 Unclassified 10987
102 Ga0123355_10065005 3300009826 Bacteria 5875
103 Ga0123355_10222356 3300009826 Bacteria 2712
104 Ga0123355_10245835 3300009826 Bacteria 2527
105 Ga0123355_10450633 3300009826 Bacteria 1622
106 Ga0123355_10696932 3300009826 Unclassified 1168
107 Ga0123355_10765585 3300009826 Unclassified 1087
108 Ga0123356_13827435 3300010049 Bacteria 519
109 Ga0123353_10000021 3300010167 Bacteria 176788
110 Ga0123353_11265931 3300010167 Bacteria 961
111 Ga0123353_11669007 3300010167 Bacteria 800
112 Ga0123353_12079843 3300010167 Bacteria 692
113 Ga0123353_12858450 3300010167 Bacteria 564
114 Ga0466695_238992 3300042595 Bacteria 1290
115 JGI24695J34938_10047707 3300002450 Bacteria 1890
116 JGI24703J35330_11748502 3300002501 Bacteria 17867
117 Ga0466716_000927 3300042605 Bacteria 3263
118 Ga0466733_150415 3300042659 Bacteria 9284
119 Ga0466735_055115 3300042624 Bacteria 1182
120 Ga0466715_180811 3300042616 Bacteria 3525
121 Ga0466726_133676 3300042619 Bacteria 28110
122 Ga0123357_10143561 3300009784 Bacteria 2925
123 Ga0123355_10042230 3300009826 Bacteria 7423
124 Ga0123355_10072660 3300009826 Bacteria 5517
125 Ga0123355_10091314 3300009826 Bacteria 4828
126 Ga0123355_10180185 3300009826 Unclassified 3137
127 Ga0123355_10441815 3300009826 Bacteria 1646
128 Ga0123356_10088283 3300010049 Bacteria 2948
129 Ga0123356_10903629 3300010049 Bacteria 1054
130 Ga0123353_10483195 3300010167 Bacteria 1812
131 Ga0415639_065394 3300038395 Bacteria 5554
132 Ga0466693_028710 3300042592 Unclassified 1153
133 JGI24703J35330_11594562 3300002501 Bacteria 1353
134 Ga0466721_120073 3300042608 Bacteria 87856
135 Ga0466733_004107 3300042659 Bacteria 5547
136 Ga0466711_388552 3300042615 Bacteria 1658
137 Ga0466715_209291 3300042616 Bacteria 20063
138 Ga0466715_291990 3300042616 Bacteria 10074
139 Ga0123357_10242259 3300009784 Bacteria 1950
140 Ga0123355_10001707 3300009826 Bacteria 30570
141 Ga0123355_10367053 3300009826 Bacteria 1890
142 Ga0123355_10505052 3300009826 Unclassified 1489
143 Ga0123355_10509266 3300009826 Bacteria 1480
144 Ga0123355_10959151 3300009826 Bacteria 916
145 Ga0123355_11048039 3300009826 Unclassified 857
146 Ga0123355_11552754 3300009826 Bacteria 641
147 Ga0123353_10493455 3300010167 Bacteria 1787
148 Ga0123353_10616143 3300010167 Bacteria 1547
149 Ga0123353_10637266 3300010167 Bacteria 1512
150 Ga0223675_1099401 3300021237 Bacteria 761
151 Ga0255809_1013158 3300022820 Bacteria 1032
152 IMNBL1DRAFT_c0001207 3300000062 Bacteria 19541
153 IMNBL1DRAFT_c0006589 3300000062 Bacteria 6310
154 JGI24695J34938_10110453 3300002450 Bacteria 1120
155 JGI24703J35330_10781260 3300002501 Unclassified 528
156 JGI24703J35330_11748393 3300002501 Bacteria 15263
157 Ga0068305_10009055 3300005083 Unclassified 20090
158 Ga0072940_1259910 3300005200 Bacteria 1490
159 Ga0466714_004368 3300042603 Bacteria 2089

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01016 Ribosomal_L27 Ribosomal L27 protein 33 112 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.