Protein Family IF02491

Metagenome Isolate
178 Members
117 Samples
109 Scaffolds
212.71 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10216447|Ga0123355_102164474
Length
232 aa
Sequence
MDTKKAAAPLPEGSESGIHSRCSGGAWGSAPLKNKKILVTGFDPFGGEKINPALEAIKQLPDKIGDISIVKCEIPTVFGKSANVLLSVVEKEHPDAVLCIGQAGGRPNIMVERVAINSNDAYIKDNEGNQPTDNKIAADGPAAYFATLPIKAMVQDMLANGIPAAVSNSAGTFVCNHVMYSILHYAAQNRPNMKTGFVHIPYLPQQTADKPSMSLDCILKGLXXXIKAIAT*

📊 Sample Types

Isolate 38.8%
Metagenome 61.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.3%
Apidae 17.3%
Termitidae 15.5%
Tenebrionidae 8.2%
Elmidae 5.5%
Kalotermitidae 3.6%
Blattidae 2.7%
Curculionidae 2.7%
Formicidae 2.7%
Culicidae 2.7%
Scarabaeidae 1.8%
Armadillidiidae 1.8%
Termopsidae 1.8%
Ceratopogonidae 0.9%
Drosophilidae 0.9%
Tephritidae 0.9%
Vespidae 0.9%
Hydrophilidae 0.9%
Pentatomidae 0.9%
Rhinotermitidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
3 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
4 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
5 2595698199 Melissococcus plutonius 60 Isolate Apidae
6 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
7 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
8 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
9 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
10 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
11 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
12 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
15 8017489919 Lactobacillus brevis EF Isolate Unclassified
16 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
17 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
18 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
19 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
20 2864937364 Acidovorax soli S00198 Isolate Elmidae
21 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
22 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
23 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
24 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
25 2595698195 Melissococcus plutonius 119 Isolate Apidae
26 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
27 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
35 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
36 2912749649 Streptomyces sp. GS7 Isolate Termitidae
37 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
38 2627853628 Melissococcus plutonius 82 Isolate Apidae
39 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
40 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
41 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
42 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
43 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
44 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
45 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
46 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
47 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
48 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
49 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
50 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
51 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
52 2595698198 Melissococcus plutonius L9 Isolate Apidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
56 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
57 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
58 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
59 3006468911 Streptomyces sp. RB17 Isolate Termitidae
60 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
61 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
62 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
63 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
64 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
65 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
66 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
67 2595698193 Melissococcus plutonius B5 Isolate Apidae
68 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
69 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
70 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
71 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
72 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
73 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
74 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
75 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
76 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
77 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
78 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
79 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
80 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
81 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
82 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
83 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
84 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
85 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
86 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
87 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
88 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
89 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
90 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
91 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
92 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
93 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
94 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
95 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
96 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
97 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
98 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
99 2595698197 Melissococcus plutonius H6 Isolate Apidae
100 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
101 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
102 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
103 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
104 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
105 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
106 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
107 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
108 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
109 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
110 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
111 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
112 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
113 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
114 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
115 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
116 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
117 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_3805 3300056790 Bacteria 9042
2 Ga0562377_0015 3300056842 Bacteria 1211570
3 Ga0562377_0086 3300056842 Bacteria 338086
4 Ga0466700_236523 3300042600 Bacteria 2984
5 Ga0123355_10001136 3300009826 Bacteria 36890
6 Ga0123355_10030126 3300009826 Bacteria 8793
7 Ga0123354_10022885 3300010882 Bacteria 9851
8 Ga0160465_100149 3300012803 Bacteria 60805
9 JGI24695J34938_10004622 3300002450 Bacteria 8945
10 JGI24697J35500_11171993 3300002507 Bacteria 1461
11 Ga0466703_325536 3300042636 Bacteria 19973
12 Ga0160430_100004 3300012852 Bacteria 419618
13 Ga0160457_1001433 3300012858 Bacteria 6577
14 Ga0466693_253408 3300042592 Bacteria 2124
15 Ga0562377_0099 3300056842 Bacteria 299601
16 Ga0562374_0021 3300057007 Bacteria 1089448
17 Ga0123355_10002619 3300009826 Bacteria 25532
18 Ga0123355_10086105 3300009826 Bacteria 4998
19 Ga0466724_05921 3300042649 Bacteria 40885
20 Ga0466724_51641 3300042649 Bacteria 75820
21 Ga0160458_107219 3300012832 Bacteria 1287
22 Ga0255572_1000129 3300026175 Bacteria 64802
23 Ga0530661_002544 3300056564 Bacteria 6721
24 Ga0562378_1586 3300056814 Bacteria 23831
25 Ga0562375_2944 3300056856 Bacteria 17419
26 Ga0562375_5921 3300056856 Bacteria 6315
27 Ga0562376_0005 3300056857 Bacteria 2173693
28 Ga0123355_10081327 3300009826 Bacteria 5169
29 Ga0123355_10269930 3300009826 Bacteria 2365
30 DPO_contig04037 2032320009 Bacteria 27294
31 Ga0466734_096572 3300042623 Bacteria 10499
32 Ga0466730_014148 3300042625 Unclassified 3266
33 Ga0466730_022530 3300042625 Bacteria 82360
34 Ga0160440_102620 3300012815 Bacteria 1846
35 Ga0160441_100878 3300012825 Unclassified 14695
36 Ga0160443_100033 3300012848 Bacteria 337370
37 Ga0255575_1004262 3300026559 Bacteria 13455
38 Ga0562379_0059 3300056790 Bacteria 474608
39 Ga0123355_10001920 3300009826 Bacteria 29220
40 Ga0123355_10018161 3300009826 Bacteria 11142
41 Ga0123355_10080814 3300009826 Bacteria 5188
42 Ga0123355_10091143 3300009826 Bacteria 4833
43 Ga0123355_10096765 3300009826 Bacteria 4662
44 Ga0123355_11032628 3300009826 Bacteria 867
45 Ga0123355_11269714 3300009826 Bacteria 743
46 HBC_ctgsDRAFT_1006658 3300000333 Bacteria 2709
47 Ga0466711_364085 3300042615 Bacteria 228323
48 Ga0466734_071258 3300042623 Bacteria 3601
49 Ga0466730_000039 3300042625 Bacteria 3647
50 Ga0466730_085996 3300042625 Bacteria 38700
51 Ga0466704_041879 3300042643 Bacteria 16053
52 Ga0466727_299560 3300042655 Bacteria 1325
53 Ga0562379_0541 3300056790 Unclassified 72448
54 Ga0562376_2058 3300056857 Unclassified 25647
55 Ga0562376_2331 3300056857 Bacteria 23008
56 Ga0466701_077466 3300042598 Bacteria 1459
57 Ga0466697_014874 3300042611 Bacteria 1546
58 Ga0123355_10467080 3300009826 Bacteria 1579
59 Ga0123356_12011329 3300010049 Bacteria 721
60 Ga0072940_1174970 3300005200 Bacteria 4340
61 Ga0074278_102634 3300005721 Unclassified 2858
62 Ga0466735_169890 3300042624 Bacteria 11089
63 Ga0466724_55152 3300042649 Bacteria 3372
64 Ga0466705_210737 3300042612 Bacteria 4625
65 Ga0562379_0372 3300056790 Bacteria 103233
66 Ga0562377_0358 3300056842 Unclassified 87064
67 Ga0562377_1213 3300056842 Bacteria 29318
68 Ga0562375_0403 3300056856 Bacteria 96431
69 Ga0562376_0015 3300056857 Unclassified 536747
70 Ga0562374_0006 3300057007 Bacteria 2178283
71 Ga0466701_034913 3300042598 Bacteria 3076
72 Ga0123355_10000408 3300009826 Bacteria 55997
73 Ga0123355_10001474 3300009826 Bacteria 32752
74 Ga0123355_10216447 3300009826 Bacteria 2764
75 Ga0160466_106731 3300012809 Bacteria 1407
76 DPO_contig06898 2032320009 Bacteria 22863
77 Ga0074278_117871 3300005721 Bacteria 11634
78 Ga0466734_147340 3300042623 Bacteria 4148
79 Ga0466725_267651 3300042654 Bacteria 3772
80 Ga0160431_100665 3300012828 Bacteria 12348
81 Ga0160431_105431 3300012828 Bacteria 2108
82 Ga0160460_102502 3300012845 Bacteria 4058
83 Ga0160443_102274 3300012848 Bacteria 4497
84 Ga0562378_2555 3300056814 Bacteria 14561
85 Ga0466701_022011 3300042598 Bacteria 293822
86 Ga0466701_058814 3300042598 Bacteria 8303
87 Ga0466701_094322 3300042598 Bacteria 2546
88 Ga0466722_088967 3300042609 Bacteria 12576
89 Ga0123355_10001660 3300009826 Bacteria 30968
90 Ga0123355_10005266 3300009826 Archaea 18890
91 Ga0123355_10462575 3300009826 Bacteria 1591
92 Ga0123355_10625151 3300009826 Bacteria 1267
93 SPBB_contig11544 2044078006 Bacteria 50017
94 Ga0466735_147649 3300042624 Bacteria 1174
95 Ga0466724_27476 3300042649 Bacteria 555291
96 Ga0160459_101583 3300012831 Bacteria 4692
97 Ga0562377_0627 3300056842 Unclassified 53379
98 Ga0562377_1729 3300056842 Unclassified 20426
99 Ga0123355_10015345 3300009826 Bacteria 12029
100 Ga0123355_10039211 3300009826 Bacteria 7706
101 Ga0123355_10109896 3300009826 Bacteria 4311
102 Ga0123355_10252494 3300009826 Bacteria 2480
103 Ga0123355_10547312 3300009826 Bacteria 1401
104 Ga0160442_106849 3300012806 Bacteria 1102
105 JGI24696J40584_12937673 3300002834 Unclassified 1608
106 Ga0111035_102043 3300007901 Unclassified 23752
107 Ga0466724_29472 3300042649 Bacteria 417400
108 Ga0466693_083789 3300042592 Bacteria 2159
109 Ga0466701_000638 3300042598 Bacteria 1743

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01470 Peptidase_C15 Pyroglutamyl peptidase 35 230 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.