Protein Family IF02474

Metagenome Isolate
183 Members
63 Samples
160 Scaffolds
142.21 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10161998|Ga0123355_101619984
Length
148 aa
Sequence
MAKKVTGMVKLQLPAGKANPAPPVGPALGPHGINIMAFCKEFNAKTQGSDMIIPVVLTVYSDRSFSLLLKTPPTSVLLKKAAGLATAKKPGSGSKEPNKNKVGKVTMKQVRELAEQKMPDMNCSSIDAAIQTVMGTARSMGIDVVDA*

📊 Sample Types

Isolate 12.6%
Metagenome 87.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 41.9%
Termitidae 33.9%
Kalotermitidae 12.9%
Termopsidae 4.8%
Passalidae 3.2%
Rhinotermitidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
2 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
3 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
4 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
8 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
9 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
10 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
11 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
25 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
38 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
44 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
45 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
46 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
47 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
48 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
50 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
51 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
52 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
53 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
60 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
61 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
62 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
63 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_123638 3300042611 Bacteria 1175
2 Ga0466705_209053 3300042612 Bacteria 327332
3 Ga0466727_322540 3300042655 Bacteria 8745
4 Ga0466715_160271 3300042616 Bacteria 60659
5 Ga0466726_195936 3300042619 Bacteria 2887
6 Ga0466706_024008 3300042599 Unclassified 3853
7 Ga0466706_043577 3300042599 Bacteria 17302
8 Ga0466717_028489 3300042604 Bacteria 1013
9 2227350237 2225789004 Bacteria 6168
10 IMNBL1DRAFT_c0001941 3300000062 Bacteria 14909
11 JGI24696J40584_12960081 3300002834 Bacteria 6273
12 Ga0068305_10045010 3300005083 Bacteria 10633
13 Ga0072940_1061801 3300005200 Unclassified 2208
14 Ga0466693_030968 3300042592 Bacteria 4910
15 Ga0123355_11175242 3300009826 Bacteria 787
16 Ga0123356_10052168 3300010049 Bacteria 3804
17 Ga0123356_10155629 3300010049 Bacteria 2276
18 Ga0123356_10629139 3300010049 Bacteria 1239
19 Ga0123356_10997138 3300010049 Bacteria 1008
20 Ga0123353_10000942 3300010167 Bacteria 35531
21 Ga0123353_10005849 3300010167 Bacteria 16250
22 Ga0123353_10008557 3300010167 Bacteria 13993
23 Ga0123353_10039508 3300010167 Bacteria 7429
24 Ga0123353_10107820 3300010167 Bacteria 4489
25 Ga0123353_10458828 3300010167 Bacteria 1873
26 Ga0123353_10562632 3300010167 Bacteria 1641
27 Ga0123354_10360172 3300010882 Unclassified 1283
28 Ga0466734_156893 3300042623 Bacteria 1475
29 Ga0466735_231464 3300042624 Bacteria 2879
30 Ga0466727_250254 3300042655 Bacteria 8801
31 Ga0466706_020471 3300042599 Bacteria 8087
32 Ga0466706_221228 3300042599 Bacteria 8650
33 Ga0466706_282502 3300042599 Bacteria 17919
34 Ga0466713_116905 3300042602 Bacteria 11872
35 Ga0466717_127017 3300042604 Bacteria 1179
36 JGI24702J35022_10035348 3300002462 Bacteria 2672
37 Ga0123357_10002664 3300009784 Bacteria 20090
38 Ga0466693_277119 3300042592 Bacteria 1362
39 Ga0123355_10346124 3300009826 Bacteria 1975
40 Ga0123356_10007167 3300010049 Bacteria 11162
41 Ga0123356_11022749 3300010049 Bacteria 996
42 Ga0123356_11375912 3300010049 Bacteria 867
43 Ga0123356_11783054 3300010049 Bacteria 765
44 Ga0123356_12838852 3300010049 Bacteria 606
45 Ga0123353_10649054 3300010167 Bacteria 1494
46 Ga0123353_12212205 3300010167 Unclassified 665
47 Ga0466703_034134 3300042636 Bacteria 37985
48 Ga0466715_380821 3300042616 Bacteria 1540
49 Ga0466706_118257 3300042599 Unclassified 1048
50 Ga0466707_166749 3300042601 Bacteria 38198
51 Ga0466714_071834 3300042603 Bacteria 2041
52 Ga0466714_134158 3300042603 Bacteria 2615
53 2227200240 2225789004 Bacteria 7791
54 2227311342 2225789004 Bacteria 6522
55 JGI24695J34938_10046459 3300002450 Bacteria 1922
56 JGI24702J35022_10008909 3300002462 Unclassified 5659
57 JGI24702J35022_10099322 3300002462 Bacteria 1592
58 Ga0123357_10000179 3300009784 Bacteria 58420
59 Ga0123357_10002703 3300009784 Bacteria 19994
60 Ga0466693_175530 3300042592 Unclassified 1346
61 Ga0123356_13104604 3300010049 Bacteria 579
62 Ga0123353_10020693 3300010167 Bacteria 9841
63 Ga0123353_10025289 3300010167 Bacteria 9043
64 Ga0123353_10348830 3300010167 Bacteria 2231
65 Ga0123353_11793654 3300010167 Bacteria 763
66 Ga0123353_12655410 3300010167 Bacteria 591
67 Ga0466731_136380 3300042622 Bacteria 1049
68 Ga0466715_410493 3300042616 Bacteria 28199
69 Ga0466718_085478 3300042617 Bacteria 1008
70 Ga0466706_019104 3300042599 Bacteria 46894
71 Ga0466706_143828 3300042599 Unclassified 14212
72 Ga0466706_147846 3300042599 Bacteria 7959
73 Ga0466706_231926 3300042599 Bacteria 55121
74 Ga0466713_142802 3300042602 Bacteria 224732
75 Ga0466716_048624 3300042605 Bacteria 1539
76 IMNBL1DRAFT_c0000501 3300000062 Bacteria 32638
77 Ga0072940_1096534 3300005200 Bacteria 4778
78 Ga0072941_1251657 3300005201 Bacteria 7283
79 Ga0466693_176632 3300042592 Bacteria 1099
80 Ga0466695_394733 3300042595 Bacteria 1000
81 Ga0123355_10082488 3300009826 Bacteria 5128
82 Ga0123355_10609483 3300009826 Bacteria 1292
83 Ga0123353_10015960 3300010167 Bacteria 10952
84 Ga0466702_231967 3300042635 Bacteria 2990
85 Ga0466710_285063 3300042613 Bacteria 1383
86 Ga0466706_016037 3300042599 Bacteria 3018
87 Ga0466706_022092 3300042599 Bacteria 2749
88 Ga0466714_153352 3300042603 Bacteria 14468
89 Ga0466719_036922 3300042606 Bacteria 1867
90 Ga0466719_544898 3300042606 Bacteria 43772
91 IMNBL1DRAFT_c0100274 3300000062 Bacteria 780
92 Ga0068305_10008613 3300005083 Bacteria 14502
93 Ga0415639_021201 3300038395 Bacteria 10751
94 Ga0123355_10196511 3300009826 Bacteria 2957
95 Ga0123356_10003056 3300010049 Bacteria 17673
96 Ga0123356_10761176 3300010049 Bacteria 1139
97 Ga0123356_11577612 3300010049 Unclassified 812
98 Ga0123356_12160135 3300010049 Bacteria 695
99 Ga0123356_12294987 3300010049 Bacteria 675
100 Ga0123356_13791194 3300010049 Bacteria 522
101 Ga0123353_10340177 3300010167 Unclassified 2266
102 Ga0123353_12021010 3300010167 Bacteria 705
103 Ga0123353_13442328 3300010167 Unclassified 501
104 Ga0466704_410324 3300042643 Bacteria 1151
105 Ga0466718_162344 3300042617 Bacteria 1132
106 Ga0466706_013298 3300042599 Bacteria 114044
107 Ga0466706_052301 3300042599 Unclassified 3235
108 Ga0466706_071968 3300042599 Bacteria 3035
109 Ga0466706_076500 3300042599 Bacteria 59694
110 Ga0466706_118979 3300042599 Bacteria 23893
111 Ga0466706_285525 3300042599 Unclassified 1303
112 Ga0123355_11046182 3300009826 Bacteria 859
113 Ga0123355_11221492 3300009826 Bacteria 764
114 Ga0123355_11383609 3300009826 Bacteria 697
115 Ga0123356_12002772 3300010049 Bacteria 722
116 Ga0466703_050530 3300042636 Bacteria 27633
117 Ga0466706_012433 3300042599 Bacteria 76595
118 Ga0466706_018452 3300042599 Bacteria 54272
119 Ga0466706_033949 3300042599 Bacteria 1634
120 Ga0466706_046737 3300042599 Bacteria 3386
121 Ga0466706_110190 3300042599 Bacteria 1546
122 Ga0466706_147248 3300042599 Bacteria 20354
123 Ga0466706_154904 3300042599 Bacteria 77574
124 Ga0466713_127827 3300042602 Bacteria 94049
125 Ga0466714_060681 3300042603 Bacteria 2154
126 Ga0466714_132559 3300042603 Bacteria 93235
127 Ga0466698_473111 3300042610 Bacteria 15959
128 IMNBL1DRAFT_c0007273 3300000062 Bacteria 5858
129 IMNBL1DRAFT_c0008906 3300000062 Unclassified 5047
130 Ga0068305_10046642 3300005083 Bacteria 33565
131 Ga0123356_10082441 3300010049 Unclassified 3045
132 Ga0123356_10822156 3300010049 Bacteria 1100
133 Ga0123356_11465648 3300010049 Bacteria 841
134 Ga0123356_12620114 3300010049 Bacteria 631
135 Ga0123353_10000891 3300010167 Bacteria 36476
136 Ga0123353_10532168 3300010167 Bacteria 1701
137 Ga0123354_10629720 3300010882 Unclassified 774
138 Ga0466731_117356 3300042622 Bacteria 1483
139 Ga0466711_046682 3300042615 Bacteria 9536
140 Ga0466718_086102 3300042617 Bacteria 1905
141 Ga0466718_094865 3300042617 Bacteria 1508
142 Ga0466726_185112 3300042619 Bacteria 38517
143 Ga0466706_105779 3300042599 Bacteria 42249
144 Ga0466706_198771 3300042599 Unclassified 3248
145 Ga0466706_240392 3300042599 Bacteria 1304
146 Ga0466707_106266 3300042601 Bacteria 1276
147 Ga0466714_033370 3300042603 Bacteria 1479
148 Ga0466722_190194 3300042609 Bacteria 120622
149 JGI24702J35022_10044744 3300002462 Bacteria 2359
150 Ga0072940_1063303 3300005200 Bacteria 2480
151 Ga0415639_038554 3300038395 Bacteria 11050
152 Ga0466696_400639 3300042596 Bacteria 20351
153 Ga0123357_10471007 3300009784 Bacteria 1070
154 Ga0123355_10039886 3300009826 Bacteria 7644
155 Ga0123355_10161998 3300009826 Bacteria 3367
156 Ga0123356_10060961 3300010049 Bacteria 3521
157 Ga0123356_11485151 3300010049 Bacteria 836
158 Ga0123353_10125153 3300010167 Bacteria 4131
159 Ga0123353_10636639 3300010167 Bacteria 1513
160 Ga0123353_12951057 3300010167 Bacteria 552

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain 9 65 0.98
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain 70 144 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.