Protein Family IF02465

Metagenome Isolate
218 Members
89 Samples
185 Scaffolds
461.36 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10148249|Ga0123355_101482491
Length
447 aa
Sequence
MKKIPYKIYLTEEEIPKAWYNVRADMKTDHRPILNPGTLMPVTAEELSPVFCDELIKQELNDTDRYIEIPEEIRDFYKMYRPSPLVRAYSLEEALDTPAKIYYKYEGGNTSGSHKLNSAIAQAYYAKKQGLKGVTTETGAGQWGTALSMACGYFGLDLKVYMVKVSAEQKPYRKGVMETFGASVTLSPSDTTNIGRLMLQNDPQTGGSLGSTDGYKYVLGSVLNQVILHQTVIGQEAKLAFEKIGDYPDIIIGSAGGGSNLGGIMLPFMADKLAGEKSPYFIAVEPSSCPSLTRGKFAYDFCDTGMVTPLAKMYTLGATFIPPKNHAGGLRYHGMSPILSQLYHDGYIDEARAVGQKELFDAAVKFAKLEGTLPAPESAHAIKAALDEAVKCKETGEAKTILFCLSGTGYFDLGAYMSYNEGTLTDLVPTDEDLERGLSAIPKVDK*

πŸ“Š Sample Types

Isolate 15.1%
Metagenome 84.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 39.8%
Termitidae 36.4%
Kalotermitidae 13.6%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Passalidae 2.3%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 208
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
2 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
3 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
4 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
5 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
6 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
14 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
15 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
16 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
17 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
28 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
36 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
37 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
38 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
39 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
53 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
61 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
62 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
63 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
64 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
65 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
66 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
72 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
73 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
74 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
75 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
76 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
77 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
78 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
79 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
80 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
81 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
82 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
83 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
84 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
85 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
86 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
87 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
88 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
89 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 2227524066 2225789004 Bacteria 3284
2 JGI24695J34938_10051012 3300002450 Bacteria 1813
3 Ga0072940_1323512 3300005200 Bacteria 2009
4 Ga0466714_166845 3300042603 Bacteria 1907
5 Ga0466722_252105 3300042609 Bacteria 44336
6 Ga0466698_072601 3300042610 Bacteria 1720
7 Ga0466712_092696 3300042614 Bacteria 3752
8 Ga0123355_10067441 3300009826 Bacteria 5757
9 Ga0123356_10004384 3300010049 Bacteria 14583
10 Ga0123356_10028007 3300010049 Unclassified 5279
11 Ga0123356_10087400 3300010049 Bacteria 2961
12 Ga0123353_10008352 3300010167 Bacteria 14130
13 Ga0123353_10100676 3300010167 Unclassified 4658
14 Ga0123353_10153545 3300010167 Unclassified 3673
15 Ga0123353_10169898 3300010167 Bacteria 3462
16 Ga0123353_10209012 3300010167 Bacteria 3063
17 Ga0123353_10320877 3300010167 Unclassified 2351
18 Ga0123354_10046854 3300010882 Bacteria 6599
19 Ga0123354_10145191 3300010882 Bacteria 2908
20 Ga0466729_229878 3300042621 Bacteria 4184
21 Ga0415639_005660 3300038395 Bacteria 69302
22 Ga0466693_121857 3300042592 Bacteria 33009
23 Ga0466696_052765 3300042596 Bacteria 20018
24 Ga0466732_455362 3300042656 Bacteria 1819
25 2227083609 2225789004 Bacteria 9990
26 IMNBL1DRAFT_c0002952 3300000062 Bacteria 11301
27 AustNasuHG_c1007160 3300000089 Bacteria 3974
28 AustNasuHG_c1029124 3300000089 Bacteria 1627
29 JGI24695J34938_10004744 3300002450 Bacteria 8794
30 JGI24702J35022_10005541 3300002462 Bacteria 7361
31 JGI24705J35276_12223307 3300002504 Bacteria 2496
32 Ga0466707_393556 3300042601 Bacteria 121495
33 Ga0466717_046336 3300042604 Bacteria 8617
34 Ga0466721_214422 3300042608 Bacteria 12139
35 Ga0466722_086496 3300042609 Bacteria 2135
36 Ga0466722_183422 3300042609 Bacteria 24688
37 Ga0466715_126788 3300042616 Bacteria 18667
38 Ga0466715_245116 3300042616 Bacteria 56913
39 Ga0123355_10365881 3300009826 Bacteria 1894
40 Ga0123356_10039226 3300010049 Bacteria 4412
41 Ga0123356_10223166 3300010049 Bacteria 1942
42 Ga0123353_10002221 3300010167 Bacteria 24044
43 Ga0123353_10051972 3300010167 Unclassified 6542
44 Ga0123353_10149807 3300010167 Bacteria 3726
45 Ga0123353_10442439 3300010167 Bacteria 1917
46 Ga0466729_214468 3300042621 Bacteria 4695
47 Ga0466731_130185 3300042622 Bacteria 1719
48 Ga0466702_058018 3300042635 Bacteria 1549
49 Ga0466704_505648 3300042643 Bacteria 44878
50 Ga0466708_220377 3300042652 Bacteria 5637
51 Ga0466692_076735 3300042591 Bacteria 1542
52 Ga0466695_214930 3300042595 Bacteria 1732
53 Ga0466696_107112 3300042596 Bacteria 2682
54 IMNBL1DRAFT_c0001961 3300000062 Bacteria 14823
55 JGI24695J34938_10014417 3300002450 Unclassified 4098
56 Ga0466713_115343 3300042602 Bacteria 67413
57 Ga0466714_093173 3300042603 Bacteria 4247
58 Ga0466717_259680 3300042604 Bacteria 6275
59 Ga0466717_295668 3300042604 Bacteria 8673
60 Ga0466722_110552 3300042609 Bacteria 5357
61 Ga0466698_362630 3300042610 Bacteria 3864
62 Ga0466723_234019 3300042618 Bacteria 4109
63 Ga0123355_10148249 3300009826 Bacteria 3571
64 Ga0123356_10000573 3300010049 Bacteria 40859
65 Ga0123356_10008097 3300010049 Bacteria 10468
66 Ga0123356_10346603 3300010049 Unclassified 1608
67 Ga0123353_10069420 3300010167 Bacteria 5661
68 Ga0123353_10173093 3300010167 Archaea 3425
69 Ga0466703_026485 3300042636 Bacteria 12930
70 Ga0466704_179314 3300042643 Bacteria 15306
71 Ga0466727_089758 3300042655 Bacteria 159388
72 Ga0415639_093970 3300038395 Bacteria 6980
73 Ga0466657_401935 3300042582 Bacteria 2617
74 Ga0466696_466134 3300042596 Bacteria 4019
75 Ga0466705_175203 3300042612 Bacteria 27231
76 Ga0466732_051850 3300042656 Bacteria 5585
77 Ga0466733_113704 3300042659 Bacteria 1773
78 Ga0466719_077282 3300042606 Bacteria 92925
79 Ga0466719_296006 3300042606 Bacteria 2609
80 Ga0466720_217745 3300042607 Bacteria 1883
81 Ga0466715_064229 3300042616 Bacteria 47985
82 Ga0466715_081361 3300042616 Bacteria 4874
83 Ga0123355_10149904 3300009826 Bacteria 3546
84 Ga0123356_10002854 3300010049 Bacteria 18281
85 Ga0123353_10027269 3300010167 Bacteria 8751
86 Ga0123353_10067305 3300010167 Bacteria 5751
87 Ga0123353_10196780 3300010167 Bacteria 3176
88 Ga0123353_10216536 3300010167 Bacteria 2999
89 Ga0466702_070425 3300042635 Bacteria 43516
90 Ga0466704_164591 3300042643 Bacteria 88701
91 Ga0466708_100580 3300042652 Bacteria 73079
92 Ga0466696_272260 3300042596 Bacteria 4370
93 AustNasuHG_c1001606 3300000089 Bacteria 8150
94 Ga0466700_243609 3300042600 Bacteria 4127
95 Ga0466707_331371 3300042601 Bacteria 8724
96 Ga0466715_476699 3300042616 Bacteria 1842
97 Ga0466715_545602 3300042616 Bacteria 41156
98 Ga0466718_134175 3300042617 Bacteria 3113
99 Ga0466723_185844 3300042618 Bacteria 2979
100 Ga0123355_10000939 3300009826 Bacteria 40311
101 Ga0123356_10023120 3300010049 Bacteria 5855
102 Ga0123356_10047492 3300010049 Bacteria 3995
103 Ga0123356_10151414 3300010049 Bacteria 2303
104 Ga0123356_10178912 3300010049 Bacteria 2141
105 Ga0123356_10272193 3300010049 Bacteria 1784
106 Ga0123353_10290832 3300010167 Bacteria 2501
107 Ga0123353_10395382 3300010167 Bacteria 2060
108 Ga0466704_155328 3300042643 Bacteria 9427
109 Ga0466708_063734 3300042652 Bacteria 25187
110 Ga0466691_187865 3300042593 Bacteria 2433
111 Ga0466696_459044 3300042596 Bacteria 1958
112 Ga0466705_281988 3300042612 Bacteria 6527
113 Ga0466705_344355 3300042612 Bacteria 21068
114 Ga0466733_000635 3300042659 Bacteria 6194
115 IMNBL1DRAFT_c0009646 3300000062 Bacteria 4737
116 JGI24702J35022_10037080 3300002462 Bacteria 2604
117 Ga0068302_10022400 3300005071 Bacteria 9068
118 Ga0068305_10246485 3300005083 Bacteria 4157
119 Ga0466707_069854 3300042601 Bacteria 2326
120 Ga0466714_082941 3300042603 Bacteria 1836
121 Ga0466714_097571 3300042603 Bacteria 3200
122 Ga0466719_364060 3300042606 Bacteria 1857
123 Ga0466722_045557 3300042609 Bacteria 252817
124 Ga0466722_099050 3300042609 Bacteria 13220
125 Ga0466705_521894 3300042612 Bacteria 138507
126 Ga0466723_206273 3300042618 Bacteria 3521
127 Ga0466726_190944 3300042619 Bacteria 3510
128 Ga0466728_019771 3300042620 Bacteria 56099
129 Ga0123356_10007428 3300010049 Bacteria 10934
130 Ga0123356_10249494 3300010049 Bacteria 1852
131 Ga0123353_10002375 3300010167 Bacteria 23381
132 Ga0123353_10071739 3300010167 Bacteria 5565
133 Ga0466702_290235 3300042635 Bacteria 2905
134 Ga0264413_118197 3300024493 Bacteria 20610
135 Ga0415639_065018 3300038395 Bacteria 1843
136 Ga0466693_423698 3300042592 Bacteria 4017
137 Ga0466694_330344 3300042594 Bacteria 5589
138 Ga0466696_256199 3300042596 Bacteria 5237
139 2230930032 2228664001 Bacteria 4415
140 JGI24698J34947_10076156 3300002449 Bacteria 1592
141 JGI24702J35022_10000804 3300002462 Bacteria 19405
142 JGI24702J35022_10025554 3300002462 Bacteria 3185
143 Ga0123357_10001928 3300009784 Unclassified 22610
144 Ga0466706_122935 3300042599 Bacteria 1543
145 Ga0466714_095330 3300042603 Bacteria 2417
146 Ga0466714_140985 3300042603 Bacteria 3835
147 Ga0466717_102305 3300042604 Bacteria 35520
148 Ga0466721_024461 3300042608 Bacteria 2468
149 Ga0466698_292285 3300042610 Bacteria 3887
150 Ga0466711_182952 3300042615 Bacteria 9864
151 Ga0466723_002382 3300042618 Bacteria 33048
152 Ga0123355_10000650 3300009826 Bacteria 47147
153 Ga0123356_10008426 3300010049 Bacteria 10252
154 Ga0123353_10002746 3300010167 Bacteria 21956
155 Ga0123353_10014113 3300010167 Bacteria 11496
156 Ga0123353_10031227 3300010167 Bacteria 8247
157 Ga0123353_10058710 3300010167 Bacteria 6165
158 Ga0123353_10105927 3300010167 Bacteria 4531
159 Ga0123353_10214068 3300010167 Bacteria 3020
160 Ga0123354_10024912 3300010882 Bacteria 9433
161 Ga0123354_10040843 3300010882 Bacteria 7174
162 Ga0466702_264075 3300042635 Bacteria 2507
163 Ga0466693_031959 3300042592 Bacteria 5914
164 Ga0466696_005522 3300042596 Bacteria 2127
165 Ga0466696_053516 3300042596 Bacteria 3248
166 Ga0466696_292037 3300042596 Bacteria 1910
167 Ga0466699_252016 3300042597 Bacteria 1944
168 JGI24695J34938_10000116 3300002450 Bacteria 71709
169 JGI24702J35022_10000005 3300002462 Bacteria 97723
170 JGI24702J35022_10010804 3300002462 Bacteria 5095
171 JGI24696J40584_12961316 3300002834 Bacteria 13499
172 Ga0466706_087918 3300042599 Bacteria 1776
173 Ga0466713_103292 3300042602 Bacteria 50986
174 Ga0466716_254710 3300042605 Bacteria 6371
175 Ga0123357_10082334 3300009784 Bacteria 4226
176 Ga0123355_10000482 3300009826 Bacteria 52802
177 Ga0123355_10102870 3300009826 Unclassified 4491
178 Ga0123356_10001010 3300010049 Bacteria 31261
179 Ga0123353_10178368 3300010167 Bacteria 3366
180 Ga0123353_10395563 3300010167 Bacteria 2059
181 Ga0123353_10440191 3300010167 Bacteria 1923
182 Ga0123354_10003309 3300010882 Bacteria 22168
183 Ga0466703_346065 3300042636 Bacteria 2036
184 Ga0466704_354926 3300042643 Bacteria 3195
185 Ga0466691_228432 3300042593 Bacteria 5130

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 80 407 0.89

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.