Protein Family IF02461

Metagenome Isolate
169 Members
57 Samples
132 Scaffolds
70.34 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10139769|Ga0123355_101397693
Length
81 aa
Sequence
MWELFKGGGAKIKDEIILKNKLKVARAEKDLSQSALAEMVGVSRNTISSIETGQFCPTAKLALILCIALDKQFEELFYFE*

📊 Sample Types

Isolate 21.9%
Metagenome 78.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 41.1%
Termitidae 28.6%
Blattidae 19.6%
Passalidae 3.6%
Scarabaeidae 3.6%
Kalotermitidae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
2 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
3 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
4 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
10 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
13 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
14 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
17 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
18 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
19 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
20 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
21 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
22 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
25 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
26 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
27 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
33 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
34 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
35 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
36 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
37 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
38 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
39 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
40 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
41 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
42 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
43 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
44 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
45 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
46 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
47 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
53 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
54 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
55 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
56 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
57 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_222673 3300042659 Bacteria 2040
2 Ga0123355_10001459 3300009826 Bacteria 32903
3 Ga0123355_10002416 3300009826 Bacteria 26397
4 Ga0123355_10016818 3300009826 Bacteria 11538
5 Ga0123355_10037268 3300009826 Bacteria 7906
6 Ga0123355_10327956 3300009826 Bacteria 2054
7 Ga0123355_10429745 3300009826 Unclassified 1681
8 Ga0123355_10583371 3300009826 Bacteria 1335
9 Ga0123355_10717721 3300009826 Bacteria 1141
10 Ga0123355_10768483 3300009826 Unclassified 1084
11 Ga0123355_10792618 3300009826 Bacteria 1059
12 Ga0123355_10818557 3300009826 Unclassified 1033
13 Ga0123355_11036593 3300009826 Unclassified 865
14 Ga0123355_11159478 3300009826 Unclassified 795
15 Ga0123356_11580264 3300010049 Unclassified 811
16 Ga0123353_10644386 3300010167 Unclassified 1502
17 Ga0123353_10773789 3300010167 Bacteria 1331
18 Ga0466706_271578 3300042599 Bacteria 2459
19 2227333290 2225789004 Bacteria 1169
20 JGI24703J35330_11592819 3300002501 Unclassified 1347
21 JGI24703J35330_11748863 3300002501 Bacteria 60401
22 Ga0466725_009950 3300042654 Bacteria 52916
23 Ga0466705_056047 3300042612 Unclassified 5775
24 Ga0415639_024345 3300038395 Bacteria 6206
25 Ga0123355_10004008 3300009826 Bacteria 21322
26 Ga0123355_10046193 3300009826 Bacteria 7084
27 Ga0123355_10123863 3300009826 Bacteria 4001
28 Ga0123355_10127141 3300009826 Bacteria 3935
29 Ga0123355_10142994 3300009826 Bacteria 3655
30 Ga0123355_10280032 3300009826 Bacteria 2304
31 Ga0123355_10630248 3300009826 Bacteria 1260
32 Ga0123355_11170001 3300009826 Bacteria 789
33 Ga0466706_000421 3300042599 Bacteria 11518
34 JGI24695J34938_10002182 3300002450 Bacteria 15273
35 Ga0466725_200228 3300042654 Bacteria 6216
36 Ga0466725_303590 3300042654 Bacteria 6180
37 Ga0466697_281640 3300042611 Bacteria 2231
38 Ga0466693_272721 3300042592 Bacteria 1142
39 Ga0123355_10000708 3300009826 Bacteria 45250
40 Ga0123355_10000929 3300009826 Bacteria 40484
41 Ga0123355_10006787 3300009826 Unclassified 17036
42 Ga0123355_10058366 3300009826 Bacteria 6242
43 Ga0123355_10477863 3300009826 Unclassified 1552
44 Ga0123355_10535282 3300009826 Unclassified 1425
45 Ga0123355_10576256 3300009826 Unclassified 1348
46 Ga0123355_11526593 3300009826 Bacteria 649
47 Ga0123356_10045767 3300010049 Bacteria 4071
48 Ga0123356_11052678 3300010049 Bacteria 983
49 Ga0123356_11095829 3300010049 Bacteria 965
50 IMNBL1DRAFT_c0090806 3300000062 Bacteria 837
51 JGI24695J34938_10278802 3300002450 Bacteria 717
52 Ga0415639_154775 3300038395 Bacteria 3764
53 Ga0123355_10001873 3300009826 Bacteria 29511
54 Ga0123355_10038254 3300009826 Unclassified 7802
55 Ga0123355_10051013 3300009826 Bacteria 6717
56 Ga0123355_10132820 3300009826 Unclassified 3831
57 Ga0123355_10284340 3300009826 Bacteria 2279
58 Ga0123355_10430474 3300009826 Bacteria 1679
59 Ga0123355_10514139 3300009826 Bacteria 1469
60 Ga0123355_11031509 3300009826 Unclassified 868
61 Ga0123355_11118225 3300009826 Bacteria 817
62 Ga0123355_11295886 3300009826 Unclassified 731
63 Ga0123353_10142221 3300010167 Bacteria 3842
64 Ga0123353_10225280 3300010167 Unclassified 2928
65 JGI24695J34938_10019018 3300002450 Bacteria 3415
66 JGI24695J34938_10301735 3300002450 Unclassified 692
67 Ga0466705_518117 3300042612 Bacteria 1110
68 Ga0466730_079356 3300042625 Bacteria 1057
69 Ga0415639_043043 3300038395 Bacteria 6871
70 Ga0415639_164002 3300038395 Bacteria 4595
71 Ga0466693_317425 3300042592 Unclassified 1369
72 Ga0466693_404202 3300042592 Bacteria 1088
73 Ga0123355_10001317 3300009826 Bacteria 34637
74 Ga0123355_10139097 3300009826 Unclassified 3721
75 Ga0123355_10299695 3300009826 Unclassified 2193
76 Ga0123355_10566820 3300009826 Bacteria 1365
77 Ga0123355_10679317 3300009826 Bacteria 1190
78 Ga0123355_10768602 3300009826 Unclassified 1084
79 Ga0123355_10995684 3300009826 Bacteria 891
80 Ga0123355_11239166 3300009826 Bacteria 756
81 Ga0123356_10039281 3300010049 Unclassified 4410
82 Ga0123356_10281751 3300010049 Unclassified 1758
83 Ga0123356_12794099 3300010049 Bacteria 611
84 Ga0123353_11008778 3300010167 Bacteria 1117
85 2227644636 2225789004 Bacteria 2036
86 JGI24695J34938_10036165 3300002450 Bacteria 2252
87 JGI24703J35330_11748353 3300002501 Bacteria 14466
88 Ga0123355_10006697 3300009826 Unclassified 17130
89 Ga0123355_10139769 3300009826 Bacteria 3709
90 Ga0123355_10208511 3300009826 Bacteria 2838
91 Ga0123355_10279640 3300009826 Unclassified 2306
92 Ga0123355_10334387 3300009826 Unclassified 2025
93 Ga0123355_10548861 3300009826 Bacteria 1398
94 Ga0123355_10949312 3300009826 Unclassified 924
95 2227123045 2225789004 Bacteria 1693
96 JGI24695J34938_10017788 3300002450 Unclassified 3570
97 JGI24703J35330_11299658 3300002501 Bacteria 848
98 Ga0123355_10000264 3300009826 Bacteria 66949
99 Ga0123355_10304833 3300009826 Unclassified 2166
100 Ga0123355_11369720 3300009826 Bacteria 702
101 Ga0123353_10192320 3300010167 Unclassified 3219
102 Ga0123353_12254391 3300010167 Unclassified 657
103 Ga0466700_234812 3300042600 Bacteria 4608
104 Ga0466698_379481 3300042610 Bacteria 1039
105 IMNBL1DRAFT_c0073279 3300000062 Bacteria 980
106 Ga0123357_10001138 3300009784 Bacteria 27628
107 Ga0466705_010884 3300042612 Bacteria 4441
108 Ga0415639_202891 3300038395 Bacteria 991
109 Ga0466693_010111 3300042592 Bacteria 2678
110 Ga0466693_086412 3300042592 Bacteria 2559
111 Ga0466693_362628 3300042592 Bacteria 3089
112 Ga0123357_10013135 3300009784 Bacteria 10720
113 Ga0123355_10013146 3300009826 Bacteria 12866
114 Ga0123355_10101781 3300009826 Unclassified 4520
115 Ga0123355_10119443 3300009826 Bacteria 4094
116 Ga0123355_10220878 3300009826 Bacteria 2725
117 Ga0123355_10373261 3300009826 Unclassified 1866
118 Ga0123355_10376928 3300009826 Unclassified 1853
119 Ga0123355_10483291 3300009826 Bacteria 1539
120 Ga0123355_10805375 3300009826 Bacteria 1046
121 Ga0123355_11130777 3300009826 Unclassified 810
122 Ga0123356_10756542 3300010049 Bacteria 1142
123 Ga0123356_10781755 3300010049 Bacteria 1125
124 Ga0123356_10974780 3300010049 Bacteria 1018
125 Ga0123356_11019230 3300010049 Unclassified 998
126 Ga0123356_11927945 3300010049 Bacteria 736
127 Ga0123356_12498427 3300010049 Bacteria 647
128 Ga0123356_13407503 3300010049 Unclassified 552
129 Ga0466701_049980 3300042598 Bacteria 1523
130 Ga0466721_369543 3300042608 Bacteria 1213
131 Ga0466698_158989 3300042610 Bacteria 1678
132 2227569087 2225789004 Bacteria 13952

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01381 HTH_3 Helix-turn-helix 22 76 0.96
PF12844 HTH_19 Helix-turn-helix domain 21 60 0.93
PF13443 HTH_26 Cro/C1-type HTH DNA-binding domain 21 80 0.89
PF13560 HTH_31 Helix-turn-helix domain 22 60 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.