Protein Family IF02446

Metagenome Isolate
140 Members
49 Samples
121 Scaffolds
241.54 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10102611|Ga0123355_101026115
Length
280 aa
Sequence
MREIPLKRNCPVKNRKIPQIDKSIFYSLRFFTSRGGTIMKKALIFQGGWDGHEPQLVSKRFAGMLEGEGFEVAIHDNLDCLADVDHLLAQDLLVACWTMGSIDNAYTQNIAKAVGEGVGLAGCHGGMCDAFRNDVLWQFITGANWVSHPGGDGIDYTVNISSSSNPITAGLTDFPVCSEHYYLHVDPAIEVLATTRFPVVPYYHSANKPVDMPVAWTKMWGLGRVFYNSLGHHDDVFDHAPNAAVLMKRGMLWAAGGKEAAKAQGLTSERFLVSDAKMF*

📊 Sample Types

Isolate 13.6%
Metagenome 86.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.8%
Termitidae 32.7%
Kalotermitidae 12.2%
Rhinotermitidae 6.1%
Termopsidae 4.1%
Hodotermitidae 2.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
2 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
5 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
6 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
21 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
22 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
23 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
24 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
25 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
32 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
38 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
45 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
46 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10003311 3300009826 Bacteria 23046
2 Ga0123355_10039895 3300009826 Bacteria 7643
3 Ga0123355_10246079 3300009826 Bacteria 2525
4 Ga0123355_10330403 3300009826 Bacteria 2043
5 Ga0123355_10441985 3300009826 Bacteria 1646
6 Ga0123356_10664985 3300010049 Bacteria 1209
7 Ga0123353_10004087 3300010167 Bacteria 18694
8 Ga0415639_129124 3300038395 Bacteria 2808
9 Ga0466714_071099 3300042603 Bacteria 1173
10 Ga0466714_122066 3300042603 Bacteria 1987
11 Ga0466714_134542 3300042603 Bacteria 3988
12 Ga0466721_183042 3300042608 Bacteria 1654
13 Ga0466721_296570 3300042608 Unclassified 3852
14 JGI24695J34938_10040108 3300002450 Bacteria 2111
15 JGI24696J40584_12852416 3300002834 Bacteria 985
16 Ga0466712_002740 3300042614 Bacteria 11418
17 Ga0123355_10003293 3300009826 Bacteria 23098
18 Ga0123355_10070910 3300009826 Bacteria 5595
19 Ga0123353_10002647 3300010167 Bacteria 22290
20 Ga0466706_253455 3300042599 Bacteria 2175
21 Ga0466707_087354 3300042601 Bacteria 1455
22 Ga0466719_041932 3300042606 Bacteria 43007
23 IMNBL1DRAFT_c0002381 3300000062 Bacteria 13122
24 JGI24695J34938_10000039 3300002450 Bacteria 98010
25 JGI24696J40584_12960194 3300002834 Bacteria 6565
26 Ga0466712_248633 3300042614 Bacteria 4298
27 Ga0466735_050467 3300042624 Bacteria 8589
28 Ga0466702_357019 3300042635 Bacteria 1541
29 Ga0466733_026158 3300042659 Bacteria 4450
30 Ga0123355_10000517 3300009826 Bacteria 51455
31 Ga0123355_10102611 3300009826 Bacteria 4498
32 Ga0123353_10429668 3300010167 Bacteria 1954
33 Ga0123353_10898871 3300010167 Bacteria 1206
34 Ga0415639_007020 3300038395 Bacteria 25604
35 Ga0466714_054907 3300042603 Unclassified 1000
36 JGI24698J34947_10001411 3300002449 Bacteria 12658
37 JGI24698J34947_10004851 3300002449 Bacteria 7363
38 JGI24695J34938_10000144 3300002450 Bacteria 64935
39 JGI24695J34938_10032386 3300002450 Bacteria 2415
40 Ga0466705_146538 3300042612 Bacteria 158344
41 Ga0123355_10000799 3300009826 Bacteria 43098
42 Ga0123355_10010003 3300009826 Bacteria 14485
43 Ga0123355_10134861 3300009826 Bacteria 3793
44 Ga0123355_10604163 3300009826 Bacteria 1300
45 Ga0123355_10745709 3300009826 Bacteria 1109
46 Ga0123356_10002401 3300010049 Bacteria 20035
47 Ga0123356_10027169 3300010049 Bacteria 5366
48 Ga0123356_10309400 3300010049 Unclassified 1688
49 Ga0123356_10315234 3300010049 Bacteria 1675
50 Ga0123353_10040814 3300010167 Bacteria 7325
51 Ga0123353_10103274 3300010167 Bacteria 4595
52 Ga0123353_10731637 3300010167 Bacteria 1381
53 Ga0466722_162514 3300042609 Bacteria 41923
54 JGI24700J35501_10929249 3300002508 Bacteria 8880
55 Ga0466705_249949 3300042612 Bacteria 8740
56 Ga0466715_488348 3300042616 Bacteria 3328
57 Ga0466718_077176 3300042617 Bacteria 21293
58 Ga0466729_077532 3300042621 Bacteria 20549
59 Ga0123355_10001652 3300009826 Bacteria 31043
60 Ga0123355_10007457 3300009826 Bacteria 16394
61 Ga0123355_10138193 3300009826 Bacteria 3738
62 Ga0123355_10255775 3300009826 Bacteria 2458
63 Ga0123355_10266034 3300009826 Bacteria 2391
64 Ga0123353_10090830 3300010167 Bacteria 4918
65 Ga0123353_10113161 3300010167 Bacteria 4369
66 Ga0123353_10287665 3300010167 Bacteria 2519
67 Ga0123353_10631912 3300010167 Bacteria 1521
68 Ga0415639_191051 3300038395 Bacteria 1123
69 Ga0466719_243384 3300042606 Bacteria 24606
70 JGI24698J34947_10003212 3300002449 Bacteria 8858
71 Ga0466705_129678 3300042612 Bacteria 34903
72 Ga0466712_075474 3300042614 Bacteria 15530
73 Ga0466711_042108 3300042615 Unclassified 1653
74 Ga0123357_10076177 3300009784 Bacteria 4431
75 Ga0123355_10000522 3300009826 Bacteria 51287
76 Ga0123355_10001327 3300009826 Bacteria 34425
77 Ga0123355_10007563 3300009826 Bacteria 16305
78 Ga0123355_10027022 3300009826 Bacteria 9267
79 Ga0123356_10023545 3300010049 Bacteria 5794
80 Ga0123356_10039337 3300010049 Bacteria 4406
81 Ga0123356_10641011 3300010049 Bacteria 1229
82 Ga0123353_10000933 3300010167 Bacteria 35737
83 Ga0123353_10003986 3300010167 Bacteria 18905
84 Ga0123353_10005639 3300010167 Bacteria 16483
85 Ga0415639_006688 3300038395 Bacteria 21406
86 Ga0415639_015999 3300038395 Bacteria 17332
87 Ga0415639_024411 3300038395 Bacteria 3912
88 Ga0466692_202197 3300042591 Bacteria 80474
89 IMNBL1DRAFT_c0021105 3300000062 Bacteria 2615
90 Ga0466705_346622 3300042612 Bacteria 1910
91 Ga0466712_195085 3300042614 Bacteria 20386
92 Ga0466703_346937 3300042636 Bacteria 9964
93 Ga0123357_10346088 3300009784 Bacteria 1429
94 Ga0123355_10025346 3300009826 Bacteria 9546
95 Ga0123355_10070308 3300009826 Bacteria 5623
96 Ga0123355_10070741 3300009826 Bacteria 5603
97 Ga0123355_10179925 3300009826 Bacteria 3140
98 Ga0123356_10162738 3300010049 Unclassified 2231
99 Ga0123353_10005090 3300010167 Bacteria 17164
100 Ga0123353_10022374 3300010167 Bacteria 9529
101 Ga0123353_10109995 3300010167 Bacteria 4439
102 Ga0123353_10601163 3300010167 Bacteria 1572
103 Ga0415639_051129 3300038395 Bacteria 5947
104 Ga0466722_259415 3300042609 Bacteria 2102
105 JGI24698J34947_10000035 3300002449 Bacteria 37551
106 Ga0466712_109437 3300042614 Bacteria 45252
107 Ga0466712_260939 3300042614 Bacteria 11973
108 Ga0466704_194134 3300042643 Bacteria 5232
109 Ga0123355_10388661 3300009826 Bacteria 1811
110 Ga0123355_10523884 3300009826 Bacteria 1448
111 Ga0123355_10814066 3300009826 Bacteria 1038
112 Ga0123356_10005660 3300010049 Bacteria 12690
113 Ga0123356_10044558 3300010049 Bacteria 4130
114 Ga0123353_10000434 3300010167 Bacteria 51822
115 Ga0123353_10836470 3300010167 Bacteria 1264
116 Ga0123354_10280747 3300010882 Bacteria 1618
117 Ga0415639_077032 3300038395 Unclassified 1983
118 JGI24698J34947_10001668 3300002449 Bacteria 11852
119 JGI24698J34947_10075358 3300002449 Bacteria 1604
120 Ga0466726_375636 3300042619 Bacteria 21985
121 Ga0466735_223595 3300042624 Bacteria 1338

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06283 ThuA Trehalose utilisation 41 254 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.