Protein Family IF02443
Metagenome
Isolate
213
Members
90
Samples
170
Scaffolds
332.08
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10097170|Ga0123355_100971704
- Length
- 336 aa
- Sequence
- MEFPGKIAIMGGGSWATAIAKMVLANESNTDINWYMRRQDRIDDFKRLKHNPAYLTNVNFDIDKIKFSSKINQVVRESDTLIFATPSPFLKQHLKKLRTNLENKNIVSAIKGIVPDENMIISEYFHEKFNVPNENILALGGPCHAEEVALDRLSYLTIGCLDREKAKVFAKHLKGYSVKTSLNDDIIGVEYASVLKNVYSIAAGICHGLKYGDNFQAVLISNALQEMNRFLNAVQPEQARNLNDSVYLGDLLVTGYSRFSRNRMFGTMIGKGYSVKTAQMEMEMIAEGYYGAKCIKEINDERYKINMPILDAVYNVLYERIAPVIEVKLLTENLR*
Sample Types
Isolate
20.2%
Metagenome
79.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.6%
Termitidae
22.5%
Kalotermitidae
14.6%
Unclassified
12.4%
Rhinotermitidae
6.7%
Passalidae
3.4%
Termopsidae
3.4%
Hydrophilidae
2.2%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
210
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 4 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 12 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 13 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 14 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 15 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 18 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 19 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 20 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 21 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 22 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 35 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 36 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 37 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 38 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 39 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 50 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 51 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 52 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 53 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 54 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 55 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 56 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 57 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 58 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 59 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 60 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 61 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 67 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 70 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 76 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 77 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 78 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 79 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 80 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 81 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 82 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 83 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 84 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 85 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 86 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 87 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 88 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 89 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 90 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_192786 | 3300042612 | Bacteria | 4136 |
| 2 | Ga0466733_002688 | 3300042659 | Bacteria | 5505 |
| 3 | Ga0466690_116612 | 3300042590 | Bacteria | 3415 |
| 4 | Ga0466690_406163 | 3300042590 | Bacteria | 6459 |
| 5 | Ga0466691_053101 | 3300042593 | Bacteria | 25087 |
| 6 | Ga0466696_129838 | 3300042596 | Bacteria | 68162 |
| 7 | Ga0466696_370918 | 3300042596 | Bacteria | 1814 |
| 8 | Ga0466706_217492 | 3300042599 | Bacteria | 2090 |
| 9 | Ga0466707_181678 | 3300042601 | Bacteria | 6198 |
| 10 | Ga0466713_105016 | 3300042602 | Bacteria | 90403 |
| 11 | Ga0466722_099081 | 3300042609 | Bacteria | 6775 |
| 12 | Ga0123357_10003901 | 3300009784 | Bacteria | 17309 |
| 13 | Ga0466726_135599 | 3300042619 | Bacteria | 11181 |
| 14 | Ga0466735_151637 | 3300042624 | Bacteria | 1380 |
| 15 | Ga0466704_119788 | 3300042643 | Bacteria | 13258 |
| 16 | IMNBL1DRAFT_c0001457 | 3300000062 | Bacteria | 17693 |
| 17 | JGI24705J35276_12218122 | 3300002504 | Bacteria | 2128 |
| 18 | JGI24699J35502_11133987 | 3300002509 | Bacteria | 22805 |
| 19 | Ga0466733_103214 | 3300042659 | Bacteria | 2475 |
| 20 | Ga0466657_263929 | 3300042582 | Bacteria | 3475 |
| 21 | Ga0466692_088376 | 3300042591 | Bacteria | 4814 |
| 22 | Ga0466696_376785 | 3300042596 | Bacteria | 25998 |
| 23 | Ga0466706_004171 | 3300042599 | Bacteria | 10782 |
| 24 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 25 | Ga0123357_10206801 | 3300009784 | Bacteria | 2217 |
| 26 | Ga0466726_169828 | 3300042619 | Bacteria | 5608 |
| 27 | Ga0466728_095171 | 3300042620 | Bacteria | 11826 |
| 28 | Ga0466731_270277 | 3300042622 | Bacteria | 2304 |
| 29 | Ga0466735_039663 | 3300042624 | Bacteria | 16485 |
| 30 | Ga0466730_052015 | 3300042625 | Bacteria | 3412 |
| 31 | Ga0466727_119437 | 3300042655 | Bacteria | 3624 |
| 32 | Ga0466727_164678 | 3300042655 | Bacteria | 3051 |
| 33 | 2227441935 | 2225789004 | Bacteria | 5474 |
| 34 | JGI24696J40584_12960899 | 3300002834 | Bacteria | 9170 |
| 35 | Ga0072941_1020210 | 3300005201 | Bacteria | 1321 |
| 36 | Ga0123357_10001158 | 3300009784 | Bacteria | 27473 |
| 37 | Ga0466705_325772 | 3300042612 | Bacteria | 8226 |
| 38 | Ga0466733_043921 | 3300042659 | Bacteria | 8407 |
| 39 | Ga0466733_153801 | 3300042659 | Bacteria | 58972 |
| 40 | Ga0466690_102734 | 3300042590 | Bacteria | 7924 |
| 41 | Ga0466692_085530 | 3300042591 | Bacteria | 25445 |
| 42 | Ga0466696_207472 | 3300042596 | Bacteria | 13849 |
| 43 | Ga0466696_490214 | 3300042596 | Bacteria | 1832 |
| 44 | Ga0466706_142882 | 3300042599 | Bacteria | 78904 |
| 45 | Ga0466707_135985 | 3300042601 | Bacteria | 9923 |
| 46 | Ga0466713_087636 | 3300042602 | Bacteria | 22335 |
| 47 | Ga0466713_091459 | 3300042602 | Bacteria | 16014 |
| 48 | Ga0466714_139645 | 3300042603 | Bacteria | 3511 |
| 49 | Ga0466716_362829 | 3300042605 | Bacteria | 4561 |
| 50 | Ga0466719_095502 | 3300042606 | Bacteria | 4988 |
| 51 | Ga0466719_290745 | 3300042606 | Bacteria | 2111 |
| 52 | Ga0466722_022637 | 3300042609 | Bacteria | 17886 |
| 53 | Ga0466722_062639 | 3300042609 | Bacteria | 2456 |
| 54 | Ga0123357_10006057 | 3300009784 | Bacteria | 14636 |
| 55 | Ga0123357_10233802 | 3300009784 | Bacteria | 2007 |
| 56 | Ga0123355_10097170 | 3300009826 | Bacteria | 4648 |
| 57 | Ga0466712_015870 | 3300042614 | Bacteria | 1744 |
| 58 | Ga0466715_274705 | 3300042616 | Bacteria | 6072 |
| 59 | Ga0466703_073365 | 3300042636 | Bacteria | 4727 |
| 60 | Ga0466704_279435 | 3300042643 | Bacteria | 16313 |
| 61 | Ga0466709_400357 | 3300042648 | Bacteria | 4999 |
| 62 | Ga0466708_083142 | 3300042652 | Bacteria | 8065 |
| 63 | Ga0466727_130038 | 3300042655 | Unclassified | 1970 |
| 64 | IMNBL1DRAFT_c0022182 | 3300000062 | Bacteria | 2519 |
| 65 | Ga0466705_081863 | 3300042612 | Bacteria | 2032 |
| 66 | Ga0466732_331536 | 3300042656 | Bacteria | 6574 |
| 67 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 68 | Ga0466691_005650 | 3300042593 | Bacteria | 8377 |
| 69 | Ga0466706_015749 | 3300042599 | Bacteria | 23160 |
| 70 | Ga0466706_049801 | 3300042599 | Bacteria | 15358 |
| 71 | Ga0466700_248051 | 3300042600 | Bacteria | 7229 |
| 72 | Ga0466707_263071 | 3300042601 | Bacteria | 1739 |
| 73 | Ga0466722_196462 | 3300042609 | Bacteria | 4281 |
| 74 | Ga0123353_10781090 | 3300010167 | Bacteria | 1323 |
| 75 | Ga0466711_275090 | 3300042615 | Bacteria | 26757 |
| 76 | Ga0466715_135030 | 3300042616 | Bacteria | 4778 |
| 77 | Ga0466715_154623 | 3300042616 | Bacteria | 15566 |
| 78 | Ga0466726_146641 | 3300042619 | Bacteria | 10357 |
| 79 | Ga0466735_052620 | 3300042624 | Bacteria | 2630 |
| 80 | Ga0466735_233308 | 3300042624 | Unclassified | 4031 |
| 81 | Ga0466703_075593 | 3300042636 | Bacteria | 5222 |
| 82 | Ga0466709_347035 | 3300042648 | Bacteria | 39954 |
| 83 | Ga0466727_109300 | 3300042655 | Bacteria | 1668 |
| 84 | JGI24702J35022_10001411 | 3300002462 | Bacteria | 14980 |
| 85 | JGI24702J35022_10028873 | 3300002462 | Bacteria | 2979 |
| 86 | JGI24705J35276_12236490 | 3300002504 | Bacteria | 8183 |
| 87 | Ga0466697_269985 | 3300042611 | Bacteria | 1585 |
| 88 | Ga0466705_223226 | 3300042612 | Bacteria | 4215 |
| 89 | Ga0466696_499310 | 3300042596 | Bacteria | 3666 |
| 90 | Ga0466701_079535 | 3300042598 | Bacteria | 72629 |
| 91 | Ga0466707_104249 | 3300042601 | Bacteria | 1907 |
| 92 | Ga0466707_351658 | 3300042601 | Bacteria | 4668 |
| 93 | Ga0466713_037511 | 3300042602 | Bacteria | 24497 |
| 94 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 95 | Ga0466714_058710 | 3300042603 | Bacteria | 109931 |
| 96 | Ga0466716_384998 | 3300042605 | Bacteria | 3126 |
| 97 | Ga0466719_362755 | 3300042606 | Bacteria | 3402 |
| 98 | Ga0123357_10019192 | 3300009784 | Bacteria | 9106 |
| 99 | Ga0123353_10391977 | 3300010167 | Bacteria | 2071 |
| 100 | Ga0123354_10326043 | 3300010882 | Bacteria | 1408 |
| 101 | Ga0466711_066406 | 3300042615 | Bacteria | 11232 |
| 102 | Ga0466715_066549 | 3300042616 | Bacteria | 10914 |
| 103 | Ga0466715_121550 | 3300042616 | Bacteria | 13380 |
| 104 | Ga0466715_132207 | 3300042616 | Bacteria | 3081 |
| 105 | Ga0466715_309209 | 3300042616 | Bacteria | 44379 |
| 106 | Ga0466715_314614 | 3300042616 | Bacteria | 16526 |
| 107 | Ga0466715_562326 | 3300042616 | Bacteria | 2543 |
| 108 | Ga0466729_265332 | 3300042621 | Bacteria | 5556 |
| 109 | Ga0466734_168132 | 3300042623 | Bacteria | 1690 |
| 110 | Ga0466735_201604 | 3300042624 | Bacteria | 1520 |
| 111 | Ga0466730_097021 | 3300042625 | Bacteria | 6399 |
| 112 | Ga0466703_332863 | 3300042636 | Bacteria | 8182 |
| 113 | Ga0466708_183987 | 3300042652 | Bacteria | 32791 |
| 114 | Ga0466727_240697 | 3300042655 | Bacteria | 4898 |
| 115 | 2227153330 | 2225789004 | Bacteria | 1579 |
| 116 | IMNBL1DRAFT_c0030218 | 3300000062 | Bacteria | 1990 |
| 117 | Ga0466705_233113 | 3300042612 | Bacteria | 5999 |
| 118 | Ga0466690_043330 | 3300042590 | Bacteria | 21806 |
| 119 | Ga0466692_077327 | 3300042591 | Bacteria | 1600 |
| 120 | Ga0466706_242325 | 3300042599 | Bacteria | 5121 |
| 121 | Ga0466706_269516 | 3300042599 | Bacteria | 14281 |
| 122 | Ga0466700_238454 | 3300042600 | Bacteria | 22788 |
| 123 | Ga0466700_257615 | 3300042600 | Bacteria | 7856 |
| 124 | Ga0466707_238733 | 3300042601 | Bacteria | 13537 |
| 125 | Ga0466714_034139 | 3300042603 | Bacteria | 66059 |
| 126 | Ga0466714_090515 | 3300042603 | Bacteria | 55724 |
| 127 | Ga0466722_210263 | 3300042609 | Bacteria | 13667 |
| 128 | Ga0123353_10782884 | 3300010167 | Bacteria | 1321 |
| 129 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 130 | Ga0466726_099783 | 3300042619 | Bacteria | 2853 |
| 131 | Ga0466735_023729 | 3300042624 | Bacteria | 7648 |
| 132 | Ga0466735_128175 | 3300042624 | Bacteria | 2607 |
| 133 | Ga0466735_133247 | 3300042624 | Bacteria | 1861 |
| 134 | Ga0466703_133171 | 3300042636 | Bacteria | 46543 |
| 135 | Ga0466703_150578 | 3300042636 | Bacteria | 11848 |
| 136 | Ga0466725_309479 | 3300042654 | Bacteria | 1255 |
| 137 | Ga0466727_098929 | 3300042655 | Bacteria | 2855 |
| 138 | 2227076901 | 2225789003 | Bacteria | 2202 |
| 139 | 2227341921 | 2225789004 | Unclassified | 1155 |
| 140 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 141 | JGI24705J35276_12230885 | 3300002504 | Bacteria | 3765 |
| 142 | JGI24699J35502_11134073 | 3300002509 | Bacteria | 28326 |
| 143 | Ga0123357_10001146 | 3300009784 | Bacteria | 27559 |
| 144 | Ga0466692_130817 | 3300042591 | Bacteria | 17236 |
| 145 | Ga0466706_054670 | 3300042599 | Bacteria | 52813 |
| 146 | Ga0466706_145766 | 3300042599 | Bacteria | 24432 |
| 147 | Ga0466719_049976 | 3300042606 | Bacteria | 6101 |
| 148 | Ga0123355_10001208 | 3300009826 | Bacteria | 35998 |
| 149 | Ga0466711_214135 | 3300042615 | Bacteria | 6089 |
| 150 | Ga0466715_194550 | 3300042616 | Bacteria | 9741 |
| 151 | Ga0466715_219042 | 3300042616 | Bacteria | 1784 |
| 152 | Ga0466734_001537 | 3300042623 | Bacteria | 2849 |
| 153 | Ga0466704_122628 | 3300042643 | Bacteria | 14887 |
| 154 | Ga0466708_104212 | 3300042652 | Bacteria | 5898 |
| 155 | JGI24699J35502_11134225 | 3300002509 | Bacteria | 74107 |
| 156 | Ga0466733_162618 | 3300042659 | Bacteria | 1414 |
| 157 | Ga0466696_323034 | 3300042596 | Bacteria | 3448 |
| 158 | Ga0466700_486479 | 3300042600 | Bacteria | 1322 |
| 159 | Ga0466707_320477 | 3300042601 | Bacteria | 18661 |
| 160 | Ga0123357_10006419 | 3300009784 | Bacteria | 14343 |
| 161 | Ga0123354_10284677 | 3300010882 | Bacteria | 1597 |
| 162 | Ga0123354_10450478 | 3300010882 | Bacteria | 1043 |
| 163 | Ga0466715_269937 | 3300042616 | Bacteria | 22829 |
| 164 | Ga0466726_135980 | 3300042619 | Bacteria | 2786 |
| 165 | Ga0466728_023725 | 3300042620 | Bacteria | 54030 |
| 166 | Ga0466735_050202 | 3300042624 | Bacteria | 2428 |
| 167 | Ga0466735_224682 | 3300042624 | Bacteria | 5438 |
| 168 | Ga0466704_244518 | 3300042643 | Bacteria | 6185 |
| 169 | Ga0466727_259105 | 3300042655 | Bacteria | 2246 |
| 170 | Ga0123357_10000419 | 3300009784 | Bacteria | 40548 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07479 | NAD_Gly3P_dh_C | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus | 185 | 323 | 0.95 |
| PF01210 | NAD_Gly3P_dh_N | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus | 6 | 164 | 0.94 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 6 | 110 | 0.93 |
| PF20618 | GPD_NAD_C_bact | Bacterial GPD, NAD-dependent C-terminal | 247 | 313 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.