Protein Family IF02392

Metagenome Isolate
120 Members
47 Samples
96 Scaffolds
253.87 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10031996|Ga0123355_100319965
Length
302 aa
Sequence
MSCKRFDLKWAEDESILRTFLRRIDDRRSPISNEIAIKFGRKNNFGGYDMKKTILKTNKLTKTFSTGGVQQHVIKNLDLEIYEGDFTVIMGASGAGKSTLLYTLSGMDSPSLGHVDFMGTDISKLNSDKMALFRRKFCGFVFQQMYLLDNMSIMDNVLACGLLVSKDAKAITSHARKLFADVNLTDEIYKKFPSQVSGGEAQRAAIVRALINKPPVIFADEPTGALNSASGAAVLDTLSKVNQNGQSIVMVTHDIKSALRGNRILYVMDGVIRGICELGFYEEGNETRRKQLGEFLSEMGW*

📊 Sample Types

Isolate 20.0%
Metagenome 80.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 48.9%
Termitidae 48.9%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
2 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 8007237282 Enterococcus sp. DIV0212c Isolate
6 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
7 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
8 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
11 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
12 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
13 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
22 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
23 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
24 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
33 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
34 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
35 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
36 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
41 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
42 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
43 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
44 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
45 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
46 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_011965 3300042623 Bacteria 1249
2 Ga0466734_122976 3300042623 Bacteria 1813
3 Ga0466700_471538 3300042600 Bacteria 1411
4 Ga0123355_10029585 3300009826 Bacteria 8871
5 Ga0123355_10046886 3300009826 Bacteria 7027
6 Ga0123355_10133640 3300009826 Bacteria 3816
7 Ga0123355_10180802 3300009826 Bacteria 3130
8 Ga0123355_10394661 3300009826 Bacteria 1790
9 Ga0123355_10455701 3300009826 Bacteria 1609
10 Ga0123355_10499285 3300009826 Bacteria 1502
11 Ga0123355_10664212 3300009826 Unclassified 1211
12 Ga0123355_10816176 3300009826 Bacteria 1036
13 Ga0123356_10009388 3300010049 Bacteria 9661
14 Ga0123353_10092666 3300010167 Bacteria 4868
15 JGI24702J35022_10000754 3300002462 Bacteria 19998
16 JGI24702J35022_10001424 3300002462 Bacteria 14923
17 JGI24696J40584_12950029 3300002834 Bacteria 2118
18 Ga0123355_10000891 3300009826 Bacteria 41353
19 Ga0123355_10002447 3300009826 Bacteria 26237
20 Ga0123355_10010248 3300009826 Bacteria 14335
21 Ga0123355_10294952 3300009826 Bacteria 2219
22 Ga0123355_10611386 3300009826 Bacteria 1289
23 Ga0123353_10000489 3300010167 Bacteria 48953
24 Ga0123353_10236040 3300010167 Unclassified 2846
25 Ga0123353_10298619 3300010167 Bacteria 2460
26 Ga0466731_303832 3300042622 Bacteria 1188
27 Ga0466698_139796 3300042610 Bacteria 48934
28 Ga0466698_336113 3300042610 Bacteria 1556
29 Ga0466697_046683 3300042611 Bacteria 2845
30 Ga0123355_10000415 3300009826 Bacteria 55479
31 Ga0123355_10001206 3300009826 Bacteria 36023
32 Ga0123355_10021712 3300009826 Bacteria 10281
33 Ga0123355_10031996 3300009826 Bacteria 8538
34 Ga0123355_10066540 3300009826 Bacteria 5800
35 Ga0123355_10479331 3300009826 Bacteria 1549
36 Ga0123356_10422607 3300010049 Bacteria 1475
37 Ga0123353_10286271 3300010167 Bacteria 2527
38 Ga0123353_11045061 3300010167 Bacteria 1092
39 JGI24695J34938_10000057 3300002450 Bacteria 89669
40 Ga0466714_093007 3300042603 Bacteria 1281
41 Ga0415639_002616 3300038395 Bacteria 37514
42 Ga0466693_220159 3300042592 Bacteria 1627
43 Ga0123355_10001354 3300009826 Bacteria 34044
44 Ga0123356_10866996 3300010049 Bacteria 1074
45 Ga0123353_10015344 3300010167 Bacteria 11123
46 Ga0123353_10063535 3300010167 Bacteria 5921
47 JGI24702J35022_10102069 3300002462 Bacteria 1571
48 Ga0072941_1003805 3300005201 Bacteria 76298
49 Ga0072941_1071348 3300005201 Bacteria 6005
50 Ga0466706_160769 3300042599 Bacteria 1176
51 Ga0466700_445614 3300042600 Bacteria 2157
52 Ga0466713_096815 3300042602 Bacteria 21628
53 Ga0466717_067430 3300042604 Bacteria 2971
54 Ga0123355_10000245 3300009826 Bacteria 69826
55 Ga0123355_10001280 3300009826 Bacteria 35112
56 Ga0123355_10002139 3300009826 Bacteria 27898
57 Ga0123355_10017088 3300009826 Bacteria 11454
58 Ga0123355_10133191 3300009826 Bacteria 3824
59 Ga0123355_10229926 3300009826 Bacteria 2650
60 Ga0123355_10358232 3300009826 Unclassified 1924
61 Ga0123356_10262195 3300010049 Bacteria 1813
62 Ga0123356_10350649 3300010049 Bacteria 1599
63 Ga0123353_10919447 3300010167 Bacteria 1188
64 JGI24703J35330_11719844 3300002501 Bacteria 2361
65 Ga0072941_1024988 3300005201 Bacteria 16539
66 Ga0466656_105332 3300042550 Bacteria 1823
67 Ga0123355_10047139 3300009826 Unclassified 7009
68 Ga0123355_10049596 3300009826 Bacteria 6825
69 Ga0123355_10387728 3300009826 Bacteria 1814
70 Ga0123356_10003728 3300010049 Bacteria 15885
71 Ga0123353_10228209 3300010167 Bacteria 2905
72 Ga0123353_10328128 3300010167 Unclassified 2318
73 Ga0123353_10990660 3300010167 Bacteria 1131
74 Ga0123354_10520033 3300010882 Bacteria 915
75 JGI24695J34938_10179097 3300002450 Bacteria 877
76 JGI24705J35276_12238530 3300002504 Bacteria 25404
77 Ga0072941_1000935 3300005201 Bacteria 118687
78 Ga0466733_138170 3300042659 Bacteria 1839
79 Ga0415639_031113 3300038395 Unclassified 2096
80 Ga0466693_132506 3300042592 Unclassified 1493
81 Ga0466695_037683 3300042595 Bacteria 1652
82 Ga0123355_10216576 3300009826 Bacteria 2763
83 Ga0123355_10413554 3300009826 Bacteria 1730
84 Ga0123355_10523256 3300009826 Unclassified 1450
85 Ga0123356_11008978 3300010049 Bacteria 1002
86 Ga0123353_10528106 3300010167 Bacteria 1710
87 Ga0123353_10658448 3300010167 Bacteria 1481
88 Ga0123353_11292940 3300010167 Bacteria 948
89 Ga0072940_1028939 3300005200 Bacteria 3244
90 Ga0466697_112864 3300042611 Bacteria 2859
91 Ga0466698_365802 3300042610 Unclassified 2878
92 Ga0123355_10000011 3300009826 Bacteria 184937
93 Ga0123355_10335255 3300009826 Bacteria 2021
94 Ga0123356_10036746 3300010049 Bacteria 4572
95 Ga0123356_10577400 3300010049 Bacteria 1287
96 JGI24702J35022_10000090 3300002462 Bacteria 40711

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 75 223 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.