Protein Family IF02377
Metagenome
Metatranscriptome
Isolate
217
Members
99
Samples
157
Scaffolds
271.94
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10020764|Ga0123355_1002076411
- Length
- 241 aa
- Sequence
- MTSLDFSEITKSKPEKSLVVHLKKHSGRNNQGKITVRHRGGGHKKKYRIIDFKRLKDDIPATVKAIEYDPNRSAHIALLAYADGEKRYIIAPNGLKVGDKLMNGPNAEIRVGNCLPMTHMPLGSEIHNIEMKPGKGAQMVRSATRIVPVTCRATLGSVGNSDHELQKIGKAGRKRHMGIRPTVRGSVMNPNDHPHGGGEGKAPIGRPAPSTPWGKPALGYKTRKKNKQSDKYIVSKRKKK*
Sample Types
Isolate
27.6%
Metagenome
71.4%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
62.2%
Termitidae
21.4%
Kalotermitidae
8.2%
Rhinotermitidae
3.1%
Passalidae
2.0%
Termopsidae
2.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 2 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 3 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 4 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 5 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 6 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 7 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 8 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 14 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 15 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 16 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 17 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 18 | 2820466401 | Unclassified Firmicutes Lab288P3bin111 | Isolate | Unclassified |
| 19 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 20 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 21 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 22 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 23 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 24 | 2791354839 | Unclassified Chloroflexi Co191P4bin10 | Isolate | Unclassified |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 36 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 37 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 38 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 39 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 40 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 41 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 44 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 45 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 52 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 53 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 54 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 55 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 56 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 57 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 58 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 59 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 64 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 65 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 66 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 67 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 68 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 69 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 70 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 71 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 74 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 75 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 76 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 77 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 78 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 79 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 80 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 81 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 82 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 83 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 84 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 85 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 86 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 87 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 88 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 89 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 90 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 91 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 92 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 93 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 94 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 95 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 96 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 97 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 98 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 99 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0255809_1012261 | 3300022820 | Bacteria | 1928 |
| 2 | Ga0415639_088488 | 3300038395 | Bacteria | 2502 |
| 3 | Ga0466700_202321 | 3300042600 | Bacteria | 13188 |
| 4 | Ga0466714_111479 | 3300042603 | Bacteria | 8086 |
| 5 | Ga0123355_10000164 | 3300009826 | Bacteria | 81449 |
| 6 | Ga0123355_10000459 | 3300009826 | Bacteria | 53637 |
| 7 | Ga0123355_10001096 | 3300009826 | Bacteria | 37400 |
| 8 | Ga0123355_10003105 | 3300009826 | Bacteria | 23706 |
| 9 | Ga0123355_10033133 | 3300009826 | Bacteria | 8390 |
| 10 | Ga0123355_10106399 | 3300009826 | Bacteria | 4398 |
| 11 | Ga0123355_10119593 | 3300009826 | Bacteria | 4090 |
| 12 | Ga0123355_10175836 | 3300009826 | Bacteria | 3188 |
| 13 | Ga0123356_10131860 | 3300010049 | Bacteria | 2450 |
| 14 | Ga0123353_10000688 | 3300010167 | Bacteria | 41343 |
| 15 | Ga0123353_10003541 | 3300010167 | Bacteria | 19772 |
| 16 | Ga0123353_10004749 | 3300010167 | Bacteria | 17612 |
| 17 | Ga0123353_10196104 | 3300010167 | Bacteria | 3183 |
| 18 | JGI24703J35330_11748514 | 3300002501 | Bacteria | 18343 |
| 19 | Ga0466729_318294 | 3300042621 | Bacteria | 2165 |
| 20 | Ga0466725_273211 | 3300042654 | Bacteria | 4127 |
| 21 | Ga0466692_142021 | 3300042591 | Bacteria | 1321 |
| 22 | Ga0466693_061628 | 3300042592 | Bacteria | 4586 |
| 23 | Ga0466693_368616 | 3300042592 | Bacteria | 2489 |
| 24 | Ga0466693_433324 | 3300042592 | Bacteria | 1885 |
| 25 | Ga0466706_040771 | 3300042599 | Bacteria | 18519 |
| 26 | Ga0466707_027338 | 3300042601 | Bacteria | 2095 |
| 27 | Ga0466707_375112 | 3300042601 | Bacteria | 17480 |
| 28 | Ga0466714_012747 | 3300042603 | Bacteria | 29171 |
| 29 | Ga0123355_10020764 | 3300009826 | Bacteria | 10499 |
| 30 | Ga0123355_10029095 | 3300009826 | Bacteria | 8938 |
| 31 | Ga0123355_10286197 | 3300009826 | Unclassified | 2268 |
| 32 | Ga0123355_10304217 | 3300009826 | Unclassified | 2169 |
| 33 | Ga0123355_10455081 | 3300009826 | Bacteria | 1610 |
| 34 | Ga0123355_10529716 | 3300009826 | Bacteria | 1436 |
| 35 | Ga0123355_10752504 | 3300009826 | Unclassified | 1101 |
| 36 | Ga0123355_10880177 | 3300009826 | Bacteria | 978 |
| 37 | Ga0123353_10570534 | 3300010167 | Bacteria | 1626 |
| 38 | IMNBL1DRAFT_c0000272 | 3300000062 | Bacteria | 45809 |
| 39 | AustNasuHG_c1011163 | 3300000089 | Bacteria | 3117 |
| 40 | JGI24695J34938_10030738 | 3300002450 | Bacteria | 2498 |
| 41 | JGI24696J40584_12957936 | 3300002834 | Bacteria | 3779 |
| 42 | Ga0466715_183088 | 3300042616 | Bacteria | 24090 |
| 43 | Ga0466703_069285 | 3300042636 | Bacteria | 1762 |
| 44 | Ga0466725_082702 | 3300042654 | Bacteria | 32093 |
| 45 | Ga0415639_009883 | 3300038395 | Bacteria | 16360 |
| 46 | Ga0415639_099741 | 3300038395 | Unclassified | 2325 |
| 47 | Ga0466700_316411 | 3300042600 | Bacteria | 1303 |
| 48 | Ga0123355_10000553 | 3300009826 | Bacteria | 50067 |
| 49 | Ga0123355_10001028 | 3300009826 | Bacteria | 38728 |
| 50 | Ga0123355_10002506 | 3300009826 | Bacteria | 26020 |
| 51 | Ga0123355_10002864 | 3300009826 | Bacteria | 24503 |
| 52 | Ga0123355_10006887 | 3300009826 | Bacteria | 16926 |
| 53 | Ga0123355_10049742 | 3300009826 | Bacteria | 6813 |
| 54 | Ga0123355_10357257 | 3300009826 | Bacteria | 1928 |
| 55 | Ga0123355_10392507 | 3300009826 | Bacteria | 1798 |
| 56 | Ga0123355_10485985 | 3300009826 | Unclassified | 1533 |
| 57 | Ga0123355_10680082 | 3300009826 | Bacteria | 1189 |
| 58 | Ga0123356_10001427 | 3300010049 | Bacteria | 26432 |
| 59 | Ga0123353_10321748 | 3300010167 | Bacteria | 2347 |
| 60 | JGI24695J34938_10000103 | 3300002450 | Bacteria | 74289 |
| 61 | JGI24695J34938_10000403 | 3300002450 | Bacteria | 42148 |
| 62 | JGI24700J35501_10930659 | 3300002508 | Bacteria | 17918 |
| 63 | Ga0466715_236292 | 3300042616 | Bacteria | 3733 |
| 64 | Ga0466693_127201 | 3300042592 | Bacteria | 1569 |
| 65 | Ga0466700_014547 | 3300042600 | Bacteria | 1393 |
| 66 | Ga0466714_041024 | 3300042603 | Bacteria | 3905 |
| 67 | Ga0123355_10000733 | 3300009826 | Bacteria | 44688 |
| 68 | Ga0123355_10002085 | 3300009826 | Bacteria | 28219 |
| 69 | Ga0123355_10002132 | 3300009826 | Bacteria | 27941 |
| 70 | Ga0123355_10003652 | 3300009826 | Bacteria | 22170 |
| 71 | Ga0123355_10013785 | 3300009826 | Bacteria | 12596 |
| 72 | Ga0123355_10085394 | 3300009826 | Bacteria | 5023 |
| 73 | Ga0123355_10168476 | 3300009826 | Bacteria | 3280 |
| 74 | Ga0123355_10442980 | 3300009826 | Bacteria | 1643 |
| 75 | Ga0123355_10583066 | 3300009826 | Unclassified | 1336 |
| 76 | Ga0123355_10617598 | 3300009826 | Unclassified | 1279 |
| 77 | IMNBL1DRAFT_c0003221 | 3300000062 | Bacteria | 10673 |
| 78 | JGI24700J35501_10924065 | 3300002508 | Bacteria | 5357 |
| 79 | Ga0466715_551822 | 3300042616 | Bacteria | 2952 |
| 80 | Ga0466727_173213 | 3300042655 | Bacteria | 5438 |
| 81 | Ga0466693_271832 | 3300042592 | Bacteria | 1583 |
| 82 | Ga0466693_337608 | 3300042592 | Unclassified | 2038 |
| 83 | Ga0466706_202240 | 3300042599 | Bacteria | 9241 |
| 84 | Ga0466714_127455 | 3300042603 | Bacteria | 1492 |
| 85 | Ga0123355_10003449 | 3300009826 | Bacteria | 22687 |
| 86 | Ga0123355_10039511 | 3300009826 | Bacteria | 7677 |
| 87 | Ga0123355_10092120 | 3300009826 | Bacteria | 4802 |
| 88 | Ga0123355_10169437 | 3300009826 | Bacteria | 3268 |
| 89 | Ga0123356_10212765 | 3300010049 | Bacteria | 1983 |
| 90 | Ga0123356_10347698 | 3300010049 | Bacteria | 1605 |
| 91 | IMNBL1DRAFT_c0011553 | 3300000062 | Bacteria | 4116 |
| 92 | JGI24703J35330_11746332 | 3300002501 | Bacteria | 5162 |
| 93 | Ga0068302_10378174 | 3300005071 | Bacteria | 2167 |
| 94 | Ga0466705_411844 | 3300042612 | Bacteria | 13683 |
| 95 | Ga0466704_556176 | 3300042643 | Bacteria | 31395 |
| 96 | Ga0466705_244395 | 3300042612 | Bacteria | 7115 |
| 97 | Ga0255809_1004350 | 3300022820 | Bacteria | 3655 |
| 98 | Ga0415639_000644 | 3300038395 | Bacteria | 27607 |
| 99 | Ga0466696_023405 | 3300042596 | Bacteria | 42390 |
| 100 | Ga0466719_154671 | 3300042606 | Bacteria | 7680 |
| 101 | Ga0123355_10000168 | 3300009826 | Bacteria | 79476 |
| 102 | Ga0123355_10005335 | 3300009826 | Bacteria | 18776 |
| 103 | Ga0123355_10193262 | 3300009826 | Bacteria | 2992 |
| 104 | Ga0123355_10440491 | 3300009826 | Bacteria | 1650 |
| 105 | Ga0123356_10283289 | 3300010049 | Bacteria | 1754 |
| 106 | Ga0123353_10000007 | 3300010167 | Bacteria | 279297 |
| 107 | Ga0123353_10137894 | 3300010167 | Bacteria | 3911 |
| 108 | Ga0123354_10012254 | 3300010882 | Bacteria | 13287 |
| 109 | JGI24695J34938_10000025 | 3300002450 | Bacteria | 108086 |
| 110 | JGI24703J35330_11748269 | 3300002501 | Bacteria | 12890 |
| 111 | JGI24703J35330_11748512 | 3300002501 | Bacteria | 18286 |
| 112 | Ga0072941_1120372 | 3300005201 | Bacteria | 5652 |
| 113 | Ga0466728_109268 | 3300042620 | Bacteria | 1449 |
| 114 | Ga0466734_082412 | 3300042623 | Bacteria | 1629 |
| 115 | Ga0466704_152059 | 3300042643 | Bacteria | 12795 |
| 116 | Ga0466693_150064 | 3300042592 | Bacteria | 1435 |
| 117 | Ga0466696_293988 | 3300042596 | Bacteria | 4873 |
| 118 | Ga0466706_217860 | 3300042599 | Bacteria | 3241 |
| 119 | Ga0466706_273553 | 3300042599 | Bacteria | 3038 |
| 120 | Ga0466713_155303 | 3300042602 | Bacteria | 17735 |
| 121 | Ga0466721_373336 | 3300042608 | Bacteria | 4345 |
| 122 | Ga0123355_10000566 | 3300009826 | Bacteria | 49780 |
| 123 | Ga0123355_10000635 | 3300009826 | Bacteria | 47525 |
| 124 | Ga0123355_10001214 | 3300009826 | Bacteria | 35876 |
| 125 | Ga0123355_10001831 | 3300009826 | Bacteria | 29750 |
| 126 | Ga0123355_10064082 | 3300009826 | Bacteria | 5925 |
| 127 | Ga0123355_10131908 | 3300009826 | Bacteria | 3848 |
| 128 | Ga0123355_10132502 | 3300009826 | Bacteria | 3836 |
| 129 | Ga0123355_10226405 | 3300009826 | Unclassified | 2679 |
| 130 | Ga0123355_10313953 | 3300009826 | Bacteria | 2121 |
| 131 | Ga0123355_10430605 | 3300009826 | Bacteria | 1678 |
| 132 | Ga0123355_10976260 | 3300009826 | Bacteria | 904 |
| 133 | Ga0123356_10093759 | 3300010049 | Bacteria | 2866 |
| 134 | Ga0123356_11231722 | 3300010049 | Bacteria | 914 |
| 135 | JGI24703J35330_11748856 | 3300002501 | Bacteria | 55836 |
| 136 | JGI24700J35501_10930310 | 3300002508 | Bacteria | 12898 |
| 137 | Ga0466711_163992 | 3300042615 | Bacteria | 16015 |
| 138 | Ga0466702_037808 | 3300042635 | Bacteria | 1607 |
| 139 | Ga0466703_007544 | 3300042636 | Bacteria | 5013 |
| 140 | Ga0466733_009951 | 3300042659 | Bacteria | 4236 |
| 141 | Ga0466706_073586 | 3300042599 | Bacteria | 52445 |
| 142 | Ga0466717_145752 | 3300042604 | Unclassified | 3428 |
| 143 | Ga0466722_186683 | 3300042609 | Bacteria | 2796 |
| 144 | Ga0123357_10428493 | 3300009784 | Bacteria | 1172 |
| 145 | Ga0123355_10004431 | 3300009826 | Bacteria | 20424 |
| 146 | Ga0123355_10050461 | 3300009826 | Bacteria | 6759 |
| 147 | Ga0123355_10102904 | 3300009826 | Bacteria | 4490 |
| 148 | Ga0123355_10120010 | 3300009826 | Bacteria | 4082 |
| 149 | Ga0123355_10346167 | 3300009826 | Unclassified | 1975 |
| 150 | Ga0123356_10226888 | 3300010049 | Bacteria | 1929 |
| 151 | Ga0123353_10325444 | 3300010167 | Unclassified | 2330 |
| 152 | 2227150260 | 2225789004 | Bacteria | 8537 |
| 153 | JGI24695J34938_10074165 | 3300002450 | Bacteria | 1416 |
| 154 | JGI24703J35330_11748024 | 3300002501 | Unclassified | 9993 |
| 155 | Ga0466729_159705 | 3300042621 | Bacteria | 9059 |
| 156 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 157 | Ga0466727_104273 | 3300042655 | Bacteria | 2226 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.