Protein Family IF02373

Metagenome Isolate
174 Members
69 Samples
149 Scaffolds
464.12 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10019414|Ga0123355_100194144
Length
526 aa
Sequence
MKNSNVHATPQFSTILNSGFSIIKNCTVVKSGISKNEFSKFILTYFVRYDILYSNPPRGENIMFFGRKKELETLSTQYTESEFSFIPIYGRRRVGKTQLIEEFVKDKLVIFFTAVNKGTYKQNMEFLSKSIFDGDEHYGVFNNFNDALETIYTRAKKEKLIFVIDEFPYLADSDKSIISILQQFIDLKFLKTDMMLILSGSSLSFMENQVLGYQSPLYGRRTGQIKLLPLDFQTARRFAPNLCKIDQATMYGVTGAIPRYLSLFSNNLSLDENIKKQYFDRNAYLFEETDNLLKQEFNDPALYKSIITAIATGSSQMKDIVGKTGEGSSTIATYMKPLLDTGIVKKEVPAMDKPNSRKTIYRLEDGMFRFWYRFVYPNASLVALDKGDMIYERIKPQIPSFMGEVFEKLCIEHMWSIYNQLPFLFQNIARWWGNNPELKSQSEIDFIAYNENEKQVIFGECKWHNEAFDLSETSFFLKKCEMFKQFEEKYYYLFSKSGFTDAVVRLATKRNDIRLINFADMFDLN*

📊 Sample Types

Isolate 14.4%
Metagenome 85.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.6%
Unclassified 34.8%
Kalotermitidae 14.5%
Termopsidae 4.3%
Rhinotermitidae 2.9%
Passalidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 8
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
2 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
3 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
4 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
5 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
13 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
14 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
23 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
24 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
38 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 2773857679 Unclassified Methanomassiliicoccaceae Cu122P4bin8 Isolate Unclassified
44 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2773857690 Unclassified Methanomassiliicoccaceae Nt197P4bin30 Isolate Unclassified
49 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
50 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
51 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
56 2773857680 Unclassified Methanomassiliicoccaceae Emb289P3bin41 Isolate Unclassified
57 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
58 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
59 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
62 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
63 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
64 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
65 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
66 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
67 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
68 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
69 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_127669 3300042611 Bacteria 2312
2 Ga0466705_335190 3300042612 Bacteria 11321
3 Ga0123355_10008502 3300009826 Bacteria 15505
4 Ga0123355_10242639 3300009826 Bacteria 2550
5 Ga0123353_10008468 3300010167 Bacteria 14051
6 Ga0123354_10157900 3300010882 Bacteria 2710
7 Ga0123354_10216403 3300010882 Unclassified 2051
8 JGI24702J35022_10000722 3300002462 Bacteria 20296
9 JGI24702J35022_10009505 3300002462 Bacteria 5454
10 Ga0466702_058130 3300042635 Bacteria 2911
11 Ga0466704_559969 3300042643 Bacteria 27165
12 Ga0466727_171561 3300042655 Archaea 28792
13 Ga0466690_166241 3300042590 Unclassified 1522
14 Ga0466692_183645 3300042591 Bacteria 2163
15 Ga0466706_196618 3300042599 Unclassified 1602
16 Ga0466706_210711 3300042599 Bacteria 5771
17 Ga0466707_257845 3300042601 Bacteria 4234
18 Ga0466717_311823 3300042604 Bacteria 4136
19 Ga0466721_027539 3300042608 Unclassified 1698
20 Ga0466721_054804 3300042608 Bacteria 120374
21 Ga0466721_232622 3300042608 Bacteria 11170
22 Ga0466711_024486 3300042615 Bacteria 17360
23 Ga0466726_069480 3300042619 Bacteria 23044
24 Ga0466705_012414 3300042612 Bacteria 4062
25 Ga0123355_10398529 3300009826 Unclassified 1777
26 JGI24695J34938_10033678 3300002450 Bacteria 2355
27 Ga0466703_353382 3300042636 Bacteria 28459
28 Ga0466703_362293 3300042636 Bacteria 12844
29 Ga0466724_67656 3300042649 Bacteria 8041
30 Ga0466708_198260 3300042652 Bacteria 3466
31 Ga0466721_212370 3300042608 Bacteria 24022
32 Ga0466705_062469 3300042612 Bacteria 4032
33 Ga0123355_10012244 3300009826 Bacteria 13282
34 Ga0123355_10015740 3300009826 Bacteria 11893
35 Ga0123355_10045168 3300009826 Bacteria 7166
36 Ga0123356_10000338 3300010049 Bacteria 53902
37 Ga0123356_10030391 3300010049 Unclassified 5056
38 Ga0123353_10006459 3300010167 Bacteria 15604
39 JGI24702J35022_10000177 3300002462 Bacteria 33679
40 JGI24705J35276_12234464 3300002504 Bacteria 5546
41 Ga0068302_10015165 3300005071 Unclassified 2575
42 Ga0068305_10038267 3300005083 Bacteria 3205
43 Ga0415639_133504 3300038395 Bacteria 2126
44 Ga0466657_099322 3300042582 Bacteria 2507
45 Ga0466697_004052 3300042611 Bacteria 1707
46 Ga0123357_10033333 3300009784 Bacteria 6997
47 Ga0123355_10144417 3300009826 Bacteria 3632
48 Ga0123355_10268905 3300009826 Bacteria 2372
49 Ga0123356_10004803 3300010049 Bacteria 13900
50 Ga0123353_10017750 3300010167 Unclassified 10483
51 JGI24695J34938_10000441 3300002450 Bacteria 40088
52 JGI24702J35022_10011696 3300002462 Bacteria 4891
53 JGI24702J35022_10025546 3300002462 Bacteria 3186
54 Ga0466702_238796 3300042635 Unclassified 1583
55 Ga0466703_285295 3300042636 Bacteria 10501
56 Ga0415639_096805 3300038395 Bacteria 3077
57 Ga0415639_097871 3300038395 Bacteria 17752
58 Ga0415639_103916 3300038395 Bacteria 1570
59 Ga0466699_163784 3300042597 Bacteria 4697
60 Ga0466707_049509 3300042601 Bacteria 1623
61 Ga0466717_254920 3300042604 Bacteria 9513
62 Ga0466721_098195 3300042608 Bacteria 1907
63 Ga0466721_117915 3300042608 Bacteria 6295
64 Ga0466711_208739 3300042615 Bacteria 4880
65 Ga0466726_357427 3300042619 Bacteria 8228
66 Ga0466733_076601 3300042659 Bacteria 1740
67 Ga0123357_10104300 3300009784 Bacteria 3642
68 Ga0123355_10019414 3300009826 Bacteria 10822
69 Ga0123355_10363624 3300009826 Bacteria 1903
70 Ga0123356_10204041 3300010049 Bacteria 2019
71 Ga0123356_10235495 3300010049 Bacteria 1898
72 Ga0123353_10180646 3300010167 Bacteria 3341
73 Ga0123353_10183010 3300010167 Bacteria 3315
74 JGI24695J34938_10023942 3300002450 Bacteria 2936
75 JGI24702J35022_10014563 3300002462 Bacteria 4337
76 Ga0466703_064978 3300042636 Unclassified 2305
77 Ga0415639_156425 3300038395 Bacteria 1802
78 Ga0415639_160519 3300038395 Unclassified 1963
79 Ga0466690_152518 3300042590 Unclassified 2525
80 Ga0466693_228326 3300042592 Bacteria 1733
81 Ga0466693_320855 3300042592 Bacteria 1582
82 Ga0466691_031376 3300042593 Bacteria 15879
83 Ga0466691_220737 3300042593 Bacteria 5032
84 Ga0466706_253181 3300042599 Bacteria 2317
85 Ga0466698_404289 3300042610 Bacteria 5657
86 Ga0466705_504722 3300042612 Unclassified 1833
87 Ga0466726_440389 3300042619 Bacteria 1743
88 Ga0466705_153580 3300042612 Bacteria 5479
89 Ga0123357_10050640 3300009784 Bacteria 5620
90 Ga0123355_10040204 3300009826 Bacteria 7613
91 Ga0123356_10000110 3300010049 Bacteria 87380
92 Ga0123356_10031982 3300010049 Bacteria 4924
93 Ga0123353_10092251 3300010167 Bacteria 4879
94 Ga0123353_10097930 3300010167 Bacteria 4727
95 Ga0123353_10114927 3300010167 Bacteria 4332
96 Ga0123353_10429445 3300010167 Bacteria 1954
97 JGI24695J34938_10026862 3300002450 Bacteria 2730
98 JGI24702J35022_10017379 3300002462 Bacteria 3931
99 JGI24703J35330_11733170 3300002501 Bacteria 2832
100 JGI24705J35276_12228562 3300002504 Bacteria 3209
101 JGI24696J40584_12959495 3300002834 Unclassified 5208
102 Ga0466703_206327 3300042636 Bacteria 6888
103 Ga0466704_580976 3300042643 Bacteria 27180
104 Ga0466727_011752 3300042655 Bacteria 2498
105 Ga0415639_017343 3300038395 Bacteria 29930
106 Ga0466694_136785 3300042594 Bacteria 4419
107 Ga0466713_107550 3300042602 Bacteria 44178
108 Ga0466719_006022 3300042606 Bacteria 3158
109 Ga0466698_435048 3300042610 Bacteria 2004
110 Ga0123355_10007968 3300009826 Bacteria 15963
111 Ga0123355_10099108 3300009826 Bacteria 4593
112 Ga0123355_10156639 3300009826 Bacteria 3444
113 Ga0123356_10151684 3300010049 Archaea 2302
114 Ga0123353_10016627 3300010167 Bacteria 10762
115 Ga0123353_10222391 3300010167 Bacteria 2951
116 Ga0123353_10261364 3300010167 Bacteria 2673
117 Ga0123353_10586151 3300010167 Bacteria 1598
118 Ga0123354_10173831 3300010882 Bacteria 2493
119 Ga0466702_082229 3300042635 Bacteria 3790
120 Ga0466703_117035 3300042636 Bacteria 7541
121 Ga0466725_019048 3300042654 Archaea 4405
122 Ga0466707_176339 3300042601 Bacteria 7241
123 Ga0466717_090511 3300042604 Bacteria 4741
124 Ga0466719_173539 3300042606 Bacteria 5361
125 Ga0466722_022504 3300042609 Bacteria 2406
126 Ga0466722_077426 3300042609 Bacteria 2070
127 Ga0466697_237794 3300042611 Bacteria 20738
128 Ga0123355_10007343 3300009826 Bacteria 16503
129 Ga0123353_10006930 3300010167 Bacteria 15230
130 Ga0123353_10068182 3300010167 Bacteria 5712
131 Ga0123353_10094624 3300010167 Bacteria 4813
132 Ga0123353_10451455 3300010167 Bacteria 1892
133 Ga0123354_10135507 3300010882 Unclassified 3082
134 IMNBL1DRAFT_c0000001 3300000062 Archaea 477011
135 JGI24703J35330_11682547 3300002501 Bacteria 1824
136 Ga0466734_113759 3300042623 Bacteria 11811
137 Ga0466702_074073 3300042635 Bacteria 2832
138 Ga0466724_28960 3300042649 Bacteria 2099
139 Ga0466692_054500 3300042591 Bacteria 32726
140 Ga0466692_122822 3300042591 Bacteria 105901
141 Ga0466693_191304 3300042592 Bacteria 4207
142 Ga0466693_377684 3300042592 Bacteria 2249
143 Ga0466701_078898 3300042598 Bacteria 4830
144 Ga0466700_296916 3300042600 Bacteria 1692
145 Ga0466714_045170 3300042603 Bacteria 3921
146 Ga0466715_221942 3300042616 Bacteria 6024
147 Ga0466718_150977 3300042617 Bacteria 1717
148 Ga0466726_354263 3300042619 Bacteria 20365
149 Ga0466728_109334 3300042620 Bacteria 26823

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_183645 Ga0466692_183645_284_1669 434
2 3300009826 Ga0123355_10015740 Ga0123355_1001574012 436
3 3300042615 Ga0466711_208739 Ga0466711_208739_2577_3962 437
4 3300010167 Ga0123353_10222391 Ga0123353_102223913 438
5 3300038395 Ga0415639_160519 Ga0415639_160519_615_1934 439
6 3300042610 Ga0466698_404289 Ga0466698_404289_1259_2641 441
7 3300010167 Ga0123353_10006459 Ga0123353_100064594 443
8 3300042635 Ga0466702_082229 Ga0466702_082229_518_1900 450
9 3300042590 Ga0466690_166241 Ga0466690_166241_43_1404 453
10 3300002501 JGI24703J35330_11733170 JGI24703J35330_117331703 454
11 3300042635 Ga0466702_058130 Ga0466702_058130_218_1600 454
12 3300042591 Ga0466692_054500 Ga0466692_054500_5205_6572 455
13 3300042609 Ga0466722_077426 Ga0466722_077426_639_2006 455
14 3300042619 Ga0466726_354263 Ga0466726_354263_15741_17108 455
15 3300042649 Ga0466724_28960 Ga0466724_28960_569_1969 455
16 3300042604 Ga0466717_090511 Ga0466717_090511_3306_4676 456
17 3300042619 Ga0466726_440389 Ga0466726_440389_70_1440 456
18 3300042655 Ga0466727_011752 Ga0466727_011752_269_1639 456
19 3300009784 Ga0123357_10050640 Ga0123357_100506402 457
20 3300038395 Ga0415639_097871 Ga0415639_097871_564_1937 457
21 3300042611 Ga0466697_004052 Ga0466697_004052_322_1695 457
22 3300042612 Ga0466705_062469 Ga0466705_062469_376_1749 457
23 iso_pr_bacteria 2820229114 2820231316 457
24 3300002462 JGI24702J35022_10009505 JGI24702J35022_100095053 458
25 3300002462 JGI24702J35022_10025546 JGI24702J35022_100255463 458
26 3300010049 Ga0123356_10004803 Ga0123356_100048038 458
27 3300042604 Ga0466717_254920 Ga0466717_254920_3941_5317 458
28 iso_pr_bacteria 2820369699 2820369906 458
29 3300009826 Ga0123355_10007968 Ga0123355_100079689 460
30 3300010167 Ga0123353_10006930 Ga0123353_1000693011 460
31 3300010167 Ga0123353_10092251 Ga0123353_100922514 460
32 3300010882 Ga0123354_10135507 Ga0123354_101355072 460
33 3300042591 Ga0466692_122822 Ga0466692_122822_63005_64387 460
34 3300042601 Ga0466707_049509 Ga0466707_049509_150_1532 460
35 3300042606 Ga0466719_173539 Ga0466719_173539_1244_2668 460
36 3300042608 Ga0466721_054804 Ga0466721_054804_103052_104434 460
37 3300042608 Ga0466721_117915 Ga0466721_117915_868_2250 460
38 3300042608 Ga0466721_232622 Ga0466721_232622_8789_10171 460
39 3300042610 Ga0466698_435048 Ga0466698_435048_454_1836 460
40 3300042636 Ga0466703_353382 Ga0466703_353382_2487_3869 460
41 iso_pr_bacteria 2820277137 2820278204 460
42 iso_pr_bacteria 2820620956 2820621041 460
43 3300010167 Ga0123353_10114927 Ga0123353_101149273 461
44 3300010167 Ga0123353_10180646 Ga0123353_101806462 461
45 3300038395 Ga0415639_017343 Ga0415639_017343_9306_10691 461
46 3300042592 Ga0466693_377684 Ga0466693_377684_267_1652 461
47 3300042608 Ga0466721_027539 Ga0466721_027539_283_1668 461
48 3300042636 Ga0466703_064978 Ga0466703_064978_534_1919 461
49 3300042636 Ga0466703_285295 Ga0466703_285295_5246_6631 461
50 3300042654 Ga0466725_019048 Ga0466725_019048_2807_4216 461
51 iso_pr_bacteria 2820220859 2820221567 461
52 iso_pr_bacteria 2820229114 2820230885 461
53 iso_pr_bacteria 2820420508 2820421275 461
54 iso_pr_bacteria 2820435670 2820438304 461
55 iso_pr_bacteria 2820620956 2820622710 461
56 iso_pr_bacteria 2820702360 2820704168 461
57 3300002450 JGI24695J34938_10026862 JGI24695J34938_100268623 462
58 3300002450 JGI24695J34938_10033678 JGI24695J34938_100336782 462
59 3300002462 JGI24702J35022_10000177 JGI24702J35022_1000017718 462
60 3300002462 JGI24702J35022_10017379 JGI24702J35022_100173794 462
61 3300005083 Ga0068305_10038267 Ga0068305_100382673 462
62 3300009784 Ga0123357_10104300 Ga0123357_101043002 462
63 3300009826 Ga0123355_10012244 Ga0123355_100122445 462
64 3300009826 Ga0123355_10099108 Ga0123355_100991084 462
65 3300009826 Ga0123355_10156639 Ga0123355_101566391 462
66 3300009826 Ga0123355_10242639 Ga0123355_102426393 462
67 3300009826 Ga0123355_10398529 Ga0123355_103985292 462
68 3300010049 Ga0123356_10031982 Ga0123356_100319824 462
69 3300010049 Ga0123356_10204041 Ga0123356_102040411 462
70 3300010049 Ga0123356_10235495 Ga0123356_102354952 462
71 3300010167 Ga0123353_10008468 Ga0123353_100084689 462
72 3300010167 Ga0123353_10016627 Ga0123353_100166272 462
73 3300010167 Ga0123353_10017750 Ga0123353_100177501 462
74 3300010167 Ga0123353_10586151 Ga0123353_105861511 462
75 3300010882 Ga0123354_10216403 Ga0123354_102164031 462
76 3300042582 Ga0466657_099322 Ga0466657_099322_614_2002 462
77 3300042592 Ga0466693_191304 Ga0466693_191304_1464_2852 462
78 3300042592 Ga0466693_320855 Ga0466693_320855_154_1542 462
79 3300042594 Ga0466694_136785 Ga0466694_136785_2863_4251 462
80 3300042602 Ga0466713_107550 Ga0466713_107550_33195_34583 462
81 3300042608 Ga0466721_212370 Ga0466721_212370_699_2087 462
82 3300042611 Ga0466697_237794 Ga0466697_237794_10082_11470 462
83 3300042635 Ga0466702_074073 Ga0466702_074073_1205_2593 462
84 iso_pr_bacteria 2820541116 2820541269 462
85 iso_pr_bacteria 2820587002 2820590016 462
86 iso_pr_bacteria 2820651690 2820653635 462
87 3300002450 JGI24695J34938_10000441 JGI24695J34938_1000044132 463
88 3300009826 Ga0123355_10045168 Ga0123355_100451687 463
89 3300009826 Ga0123355_10144417 Ga0123355_101444173 463
90 3300010167 Ga0123353_10429445 Ga0123353_104294452 463
91 3300010167 Ga0123353_10451455 Ga0123353_104514552 463
92 3300038395 Ga0415639_103916 Ga0415639_103916_101_1507 463
93 3300042597 Ga0466699_163784 Ga0466699_163784_1805_3196 463
94 iso_pr_bacteria 2820008971 2820010191 463
95 iso_pr_bacteria 2820229114 2820230259 463
96 iso_pr_bacteria 2820350530 2820352825 463
97 3300002450 JGI24695J34938_10023942 JGI24695J34938_100239421 464
98 3300002462 JGI24702J35022_10011696 JGI24702J35022_100116962 464
99 3300009826 Ga0123355_10007343 Ga0123355_1000734312 464
100 3300010167 Ga0123353_10097930 Ga0123353_100979302 464
101 3300010167 Ga0123353_10183010 Ga0123353_101830101 464
102 3300038395 Ga0415639_133504 Ga0415639_133504_72_1466 464
103 3300042593 Ga0466691_220737 Ga0466691_220737_2554_3948 464
104 3300042603 Ga0466714_045170 Ga0466714_045170_1042_2436 464
105 3300042612 Ga0466705_504722 Ga0466705_504722_54_1448 464
106 3300042617 Ga0466718_150977 Ga0466718_150977_193_1587 464
107 3300042620 Ga0466728_109334 Ga0466728_109334_481_1875 464
108 3300042623 Ga0466734_113759 Ga0466734_113759_5010_6404 464
109 3300042643 Ga0466704_559969 Ga0466704_559969_20930_22324 464
110 3300042643 Ga0466704_580976 Ga0466704_580976_14894_16288 464
111 iso_pr_bacteria 2820566695 2820567242 464
112 3300009826 Ga0123355_10363624 Ga0123355_103636242 465
113 3300010049 Ga0123356_10000110 Ga0123356_1000011011 465
114 3300010882 Ga0123354_10157900 Ga0123354_101579002 465
115 3300042604 Ga0466717_311823 Ga0466717_311823_1200_2597 465
116 3300042636 Ga0466703_117035 Ga0466703_117035_5936_7333 465
117 3300042636 Ga0466703_206327 Ga0466703_206327_3062_4459 465
118 3300042655 Ga0466727_171561 Ga0466727_171561_20843_22240 465
119 iso_pr_bacteria 2820563109 2820564374 465
120 iso_pu_archaea 2773857680 2774152299 465
121 3300009826 Ga0123355_10268905 Ga0123355_102689052 466
122 3300010049 Ga0123356_10000338 Ga0123356_1000033828 466
123 3300010049 Ga0123356_10030391 Ga0123356_100303913 466
124 3300038395 Ga0415639_096805 Ga0415639_096805_122_1522 466
125 3300042598 Ga0466701_078898 Ga0466701_078898_2832_4232 466
126 3300042600 Ga0466700_296916 Ga0466700_296916_280_1680 466
127 3300042601 Ga0466707_257845 Ga0466707_257845_2282_3682 466
128 3300042615 Ga0466711_024486 Ga0466711_024486_13500_14900 466
129 3300042619 Ga0466726_357427 Ga0466726_357427_2396_3796 466
130 iso_pr_bacteria 2820800812 2820802180 466
131 3300002462 JGI24702J35022_10000722 JGI24702J35022_1000072214 467
132 3300002501 JGI24703J35330_11682547 JGI24703J35330_116825472 467
133 3300010167 Ga0123353_10261364 Ga0123353_102613642 467
134 3300038395 Ga0415639_156425 Ga0415639_156425_67_1470 467
135 3300042590 Ga0466690_152518 Ga0466690_152518_20_1423 467
136 3300042593 Ga0466691_031376 Ga0466691_031376_13893_15296 467
137 3300009826 Ga0123355_10008502 Ga0123355_100085025 468
138 3300042599 Ga0466706_196618 Ga0466706_196618_151_1557 468
139 3300042611 Ga0466697_127669 Ga0466697_127669_99_1505 468
140 3300042612 Ga0466705_012414 Ga0466705_012414_2240_3646 468
141 3300042649 Ga0466724_67656 Ga0466724_67656_1888_3294 468
142 iso_pu_archaea 2773857690 2774164445 468
143 3300002504 JGI24705J35276_12234464 JGI24705J35276_122344642 469
144 3300005071 Ga0068302_10015165 Ga0068302_100151652 469
145 3300010167 Ga0123353_10094624 Ga0123353_100946242 469
146 3300042599 Ga0466706_253181 Ga0466706_253181_687_2096 469
147 3300042612 Ga0466705_153580 Ga0466705_153580_1043_2452 469
148 3300009826 Ga0123355_10040204 Ga0123355_100402045 470
149 3300010049 Ga0123356_10151684 Ga0123356_101516842 471
150 3300042592 Ga0466693_228326 Ga0466693_228326_155_1570 471
151 3300002834 JGI24696J40584_12959495 JGI24696J40584_129594952 472
152 3300042619 Ga0466726_069480 Ga0466726_069480_6999_8417 472
153 iso_pr_bacteria 2820418027 2820420387 472
154 iso_pu_archaea 2773857679 2774150452 472
155 iso_pu_archaea 2773857679 2774150580 472
156 3300010167 Ga0123353_10068182 Ga0123353_100681821 473
157 iso_pr_bacteria 2820492969 2820492970 473
158 3300009784 Ga0123357_10033333 Ga0123357_100333333 474
159 3300042599 Ga0466706_210711 Ga0466706_210711_341_1765 474
160 3300042635 Ga0466702_238796 Ga0466702_238796_11_1435 474
161 3300042659 Ga0466733_076601 Ga0466733_076601_236_1660 474
162 3300002462 JGI24702J35022_10014563 JGI24702J35022_100145632 476
163 3300042636 Ga0466703_362293 Ga0466703_362293_2060_3490 476
164 3300042652 Ga0466708_198260 Ga0466708_198260_1082_2515 477
165 3300000062 IMNBL1DRAFT_c0000001 IMNBL1DRAFT_0000001376 480
166 3300042608 Ga0466721_098195 Ga0466721_098195_412_1857 481
167 3300042606 Ga0466719_006022 Ga0466719_006022_1519_2973 484
168 3300002504 JGI24705J35276_12228562 JGI24705J35276_122285622 486
169 3300042612 Ga0466705_335190 Ga0466705_335190_4492_5958 488
170 3300010882 Ga0123354_10173831 Ga0123354_101738312 489
171 3300042616 Ga0466715_221942 Ga0466715_221942_2430_3899 489
172 3300042609 Ga0466722_022504 Ga0466722_022504_219_1739 490
173 3300042601 Ga0466707_176339 Ga0466707_176339_2596_4194 515
174 3300009826 Ga0123355_10019414 Ga0123355_100194144 526

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03008 DUF234 Archaea bacterial proteins of unknown function 371 465 0.93
PF01637 ATPase_2 ATPase domain predominantly from Archaea 64 262 0.91
PF13173 AAA_14 AAA domain 86 233 0.65

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01637 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.