Protein Family IF02369

Metagenome Isolate
150 Members
55 Samples
132 Scaffolds
339.79 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10017524|Ga0123355_100175247
Length
396 aa
Sequence
MSELEKNPVEEKTDDYENDPSVVTRFHALALSSTGAIIYWRNGYVGALTHWHVLIIYWRNGLVRYYVKRSMWFLITLVAAVVLNFILPRLMPGDPLTAIMQRVIPGGGGFVDADAIRRIYEHYMELFGLDRPLIVQFGMYVRNLISGDWGQSFARFPREITDIIASALPWTIGLQLPAIITGWILGNILGALAAYKKSGFDKVLMPATLFVSGIPAFGLAVVLLSVFALGLGWFPVSGGYEMGMIPHFSWRFIASIIEHYHLPFWSIVLISIGGQAIGMRSMSIYELNADYVKYSRFMGIKDRKIVRYVFRNAMLPQVTGLAVSIGTMMGGAIVAEMIFSYPGLGTQLLQAIGGRDFPLITGIALVITVMVLVSVFILEIIYGLIDPRIKATQYE*

📊 Sample Types

Isolate 11.3%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 29.1%
Kalotermitidae 18.2%
Termopsidae 5.5%
Passalidae 3.6%
Hodotermitidae 1.8%
Rhinotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 1
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
2 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
3 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
4 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
5 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
13 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
36 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
37 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
38 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
43 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
47 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_318960 3300042643 Bacteria 8838
2 Ga0466715_078925 3300042616 Bacteria 42675
3 Ga0466715_175257 3300042616 Bacteria 5128
4 Ga0123355_10017524 3300009826 Bacteria 11324
5 Ga0123356_10012128 3300010049 Bacteria 8377
6 Ga0123356_10067686 3300010049 Bacteria 3344
7 Ga0123356_10143243 3300010049 Bacteria 2361
8 Ga0123356_10518719 3300010049 Bacteria 1350
9 Ga0123356_10585315 3300010049 Unclassified 1280
10 Ga0466699_213646 3300042597 Bacteria 1207
11 JGI24695J34938_10001052 3300002450 Bacteria 25033
12 Ga0466714_116473 3300042603 Bacteria 3404
13 Ga0466702_091917 3300042635 Bacteria 1329
14 Ga0466704_085890 3300042643 Bacteria 10599
15 Ga0466708_211425 3300042652 Bacteria 37566
16 Ga0466726_031252 3300042619 Bacteria 1663
17 Ga0123356_10003258 3300010049 Bacteria 17041
18 Ga0123356_10003892 3300010049 Unclassified 15550
19 Ga0123356_10046563 3300010049 Unclassified 4035
20 Ga0123353_10001677 3300010167 Bacteria 27245
21 Ga0123353_10031955 3300010167 Bacteria 8166
22 Ga0123353_10322954 3300010167 Bacteria 2341
23 Ga0123353_10790945 3300010167 Bacteria 1312
24 Ga0466694_185965 3300042594 Bacteria 1946
25 Ga0466707_239677 3300042601 Bacteria 4573
26 Ga0466714_155102 3300042603 Bacteria 4271
27 Ga0466732_003284 3300042656 Viruses 1676
28 Ga0466703_216350 3300042636 Unclassified 8637
29 Ga0466715_289164 3300042616 Bacteria 65907
30 Ga0123355_10009182 3300009826 Bacteria 15004
31 Ga0123355_10239339 3300009826 Bacteria 2575
32 Ga0123356_10001040 3300010049 Bacteria 30779
33 Ga0123356_10401227 3300010049 Bacteria 1509
34 Ga0123353_10021035 3300010167 Bacteria 9773
35 Ga0123353_10301588 3300010167 Bacteria 2445
36 Ga0123353_10653795 3300010167 Unclassified 1487
37 Ga0415639_023595 3300038395 Bacteria 18137
38 Ga0466706_092384 3300042599 Bacteria 8853
39 Ga0466714_018125 3300042603 Bacteria 2162
40 Ga0466717_236299 3300042604 Bacteria 7343
41 Ga0466702_023793 3300042635 Bacteria 3006
42 Ga0466702_226122 3300042635 Unclassified 1282
43 Ga0466712_211292 3300042614 Bacteria 10253
44 Ga0466715_009917 3300042616 Bacteria 61111
45 Ga0123355_10000375 3300009826 Bacteria 57436
46 Ga0123355_10002373 3300009826 Bacteria 26626
47 Ga0123355_10027554 3300009826 Bacteria 9177
48 Ga0123356_10016314 3300010049 Bacteria 7093
49 Ga0123356_10028154 3300010049 Bacteria 5264
50 Ga0123356_10040704 3300010049 Unclassified 4329
51 Ga0123356_10047908 3300010049 Bacteria 3976
52 Ga0123356_10097762 3300010049 Bacteria 2810
53 Ga0123356_10128427 3300010049 Bacteria 2479
54 Ga0123356_10173156 3300010049 Bacteria 2172
55 Ga0123356_10317209 3300010049 Bacteria 1670
56 Ga0123353_10124815 3300010167 Bacteria 4137
57 Ga0123353_10362549 3300010167 Bacteria 2177
58 Ga0123353_10547747 3300010167 Bacteria 1670
59 Ga0123353_10856928 3300010167 Unclassified 1244
60 Ga0415639_007854 3300038395 Bacteria 28706
61 Ga0466696_066776 3300042596 Bacteria 100039
62 Ga0466699_290333 3300042597 Bacteria 1213
63 IMNBL1DRAFT_c0048901 3300000062 Bacteria 1352
64 JGI24698J34947_10000732 3300002449 Bacteria 16161
65 JGI24698J34947_10004552 3300002449 Bacteria 7553
66 JGI24698J34947_10014545 3300002449 Bacteria 4285
67 JGI24695J34938_10000068 3300002450 Bacteria 86379
68 Ga0466700_458164 3300042600 Bacteria 1373
69 Ga0466714_085086 3300042603 Bacteria 3471
70 Ga0466722_174804 3300042609 Bacteria 1497
71 Ga0466735_101938 3300042624 Unclassified 1739
72 Ga0466725_404895 3300042654 Bacteria 1389
73 Ga0466727_282832 3300042655 Bacteria 2675
74 Ga0466711_411250 3300042615 Bacteria 13919
75 Ga0123355_10049324 3300009826 Bacteria 6845
76 Ga0123356_10015181 3300010049 Unclassified 7384
77 Ga0123356_10017637 3300010049 Bacteria 6791
78 Ga0123356_10125440 3300010049 Bacteria 2505
79 Ga0123356_10178557 3300010049 Bacteria 2142
80 Ga0123356_10191994 3300010049 Bacteria 2074
81 Ga0123353_10058682 3300010167 Bacteria 6167
82 Ga0123353_10238326 3300010167 Bacteria 2829
83 2227648789 2225789004 Bacteria 2014
84 Ga0466700_207467 3300042600 Bacteria 2519
85 Ga0466721_023587 3300042608 Bacteria 3751
86 Ga0466697_179208 3300042611 Bacteria 3780
87 Ga0466711_248273 3300042615 Bacteria 54349
88 Ga0466711_264041 3300042615 Bacteria 33159
89 Ga0123355_10000031 3300009826 Bacteria 139810
90 Ga0123355_10000608 3300009826 Bacteria 48311
91 Ga0123355_10411785 3300009826 Bacteria 1735
92 Ga0123356_10000487 3300010049 Bacteria 44177
93 Ga0123353_10475232 3300010167 Bacteria 1831
94 Ga0123353_10578024 3300010167 Bacteria 1613
95 Ga0466714_062084 3300042603 Bacteria 6113
96 Ga0466716_116860 3300042605 Bacteria 2562
97 Ga0466719_501847 3300042606 Bacteria 27786
98 Ga0466721_312619 3300042608 Bacteria 2302
99 Ga0466698_511050 3300042610 Bacteria 1724
100 Ga0466732_084269 3300042656 Bacteria 10500
101 Ga0466725_387343 3300042654 Bacteria 1422
102 Ga0466711_282344 3300042615 Bacteria 1967
103 Ga0466715_513015 3300042616 Bacteria 30758
104 Ga0123357_10090587 3300009784 Unclassified 3988
105 Ga0123355_10061921 3300009826 Bacteria 6041
106 Ga0123356_10000074 3300010049 Bacteria 105474
107 Ga0123356_10018908 3300010049 Bacteria 6535
108 Ga0123356_10041174 3300010049 Bacteria 4304
109 Ga0123356_10085013 3300010049 Bacteria 3000
110 Ga0123356_10469589 3300010049 Bacteria 1409
111 Ga0123353_10008776 3300010167 Bacteria 13848
112 Ga0123353_10083554 3300010167 Bacteria 5138
113 Ga0415639_009279 3300038395 Bacteria 15601
114 Ga0072940_1081547 3300005200 Bacteria 7843
115 Ga0466701_036598 3300042598 Bacteria 6457
116 Ga0466700_282459 3300042600 Bacteria 1770
117 Ga0466721_066750 3300042608 Bacteria 7201
118 Ga0466721_390545 3300042608 Bacteria 3210
119 Ga0466705_222541 3300042612 Unclassified 11271
120 Ga0466702_203097 3300042635 Bacteria 1566
121 Ga0466723_013393 3300042618 Bacteria 6862
122 Ga0123355_10000252 3300009826 Bacteria 68866
123 Ga0123355_10038271 3300009826 Bacteria 7799
124 Ga0123356_10000037 3300010049 Bacteria 142433
125 Ga0123356_10019091 3300010049 Bacteria 6502
126 Ga0123356_10080126 3300010049 Bacteria 3086
127 Ga0123356_10318568 3300010049 Bacteria 1667
128 Ga0123356_10424511 3300010049 Bacteria 1472
129 Ga0123353_10069877 3300010167 Bacteria 5641
130 Ga0123353_10746148 3300010167 Bacteria 1363
131 IMNBL1DRAFT_c0007514 3300000062 Bacteria 5717
132 Ga0466719_210745 3300042606 Bacteria 2816

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125652 2781311140 280
2 3300042614 Ga0466712_211292 Ga0466712_211292_2349_3239 296
3 3300010167 Ga0123353_10856928 Ga0123353_108569282 316
4 3300005200 Ga0072940_1081547 Ga0072940_10815478 319
5 3300042654 Ga0466725_387343 Ga0466725_387343_421_1380 319
6 3300010049 Ga0123356_10128427 Ga0123356_101284272 320
7 3300042608 Ga0466721_066750 Ga0466721_066750_178_1185 320
8 3300010049 Ga0123356_10085013 Ga0123356_100850132 321
9 3300042656 Ga0466732_003284 Ga0466732_003284_48_1061 321
10 3300010049 Ga0123356_10003258 Ga0123356_1000325816 322
11 3300010167 Ga0123353_10238326 Ga0123353_102383262 322
12 3300042616 Ga0466715_009917 Ga0466715_009917_29373_30341 322
13 3300042654 Ga0466725_404895 Ga0466725_404895_34_1002 322
14 3300010049 Ga0123356_10518719 Ga0123356_105187192 323
15 3300038395 Ga0415639_009279 Ga0415639_009279_12408_13412 323
16 3300010167 Ga0123353_10021035 Ga0123353_100210356 324
17 3300042656 Ga0466732_084269 Ga0466732_084269_6719_7732 324
18 3300010049 Ga0123356_10317209 Ga0123356_103172092 325
19 3300010167 Ga0123353_10322954 Ga0123353_103229542 325
20 3300042597 Ga0466699_213646 Ga0466699_213646_50_1063 325
21 3300042608 Ga0466721_390545 Ga0466721_390545_222_1229 325
22 3300009826 Ga0123355_10061921 Ga0123355_100619211 326
23 3300038395 Ga0415639_023595 Ga0415639_023595_13515_14525 326
24 3300042600 Ga0466700_207467 Ga0466700_207467_1248_2252 326
25 3300010049 Ga0123356_10001040 Ga0123356_100010402 327
26 3300042616 Ga0466715_175257 Ga0466715_175257_251_1270 327
27 3300042603 Ga0466714_062084 Ga0466714_062084_1919_2926 329
28 3300009826 Ga0123355_10027554 Ga0123355_100275545 333
29 3300010049 Ga0123356_10046563 Ga0123356_100465634 333
30 3300010167 Ga0123353_10001677 Ga0123353_1000167721 333
31 iso_pr_bacteria 2820563109 2820563309 333
32 2225789004 2227648789 2228243214 334
33 3300010049 Ga0123356_10000037 Ga0123356_1000003711 334
34 3300010049 Ga0123356_10469589 Ga0123356_104695892 334
35 3300042596 Ga0466696_066776 Ga0466696_066776_75179_76183 334
36 3300042598 Ga0466701_036598 Ga0466701_036598_3540_4544 334
37 3300042600 Ga0466700_282459 Ga0466700_282459_339_1343 334
38 3300042603 Ga0466714_018125 Ga0466714_018125_1086_2090 334
39 3300042603 Ga0466714_116473 Ga0466714_116473_541_1545 334
40 3300042603 Ga0466714_155102 Ga0466714_155102_2533_3537 334
41 3300042604 Ga0466717_236299 Ga0466717_236299_1237_2241 334
42 3300042606 Ga0466719_501847 Ga0466719_501847_16881_17885 334
43 3300042609 Ga0466722_174804 Ga0466722_174804_445_1449 334
44 3300042615 Ga0466711_411250 Ga0466711_411250_7928_8932 334
45 3300042616 Ga0466715_513015 Ga0466715_513015_3568_4572 334
46 3300042643 Ga0466704_085890 Ga0466704_085890_6949_7953 334
47 3300042655 Ga0466727_282832 Ga0466727_282832_1292_2296 334
48 iso_pr_bacteria 2820267566 2820271049 334
49 iso_pr_bacteria 2820389254 2820390436 334
50 iso_pr_bacteria 2820492969 2820494924 334
51 3300000062 IMNBL1DRAFT_c0007514 IMNBL1DRAFT_00075144 335
52 3300000062 IMNBL1DRAFT_c0048901 IMNBL1DRAFT_00489012 335
53 3300010049 Ga0123356_10018908 Ga0123356_100189084 335
54 3300010049 Ga0123356_10040704 Ga0123356_100407043 335
55 3300010049 Ga0123356_10080126 Ga0123356_100801262 335
56 3300010049 Ga0123356_10178557 Ga0123356_101785572 335
57 3300010049 Ga0123356_10191994 Ga0123356_101919942 335
58 3300010049 Ga0123356_10424511 Ga0123356_104245111 335
59 3300010049 Ga0123356_10585315 Ga0123356_105853151 335
60 3300010167 Ga0123353_10008776 Ga0123353_1000877611 335
61 3300010167 Ga0123353_10475232 Ga0123353_104752322 335
62 3300010167 Ga0123353_10547747 Ga0123353_105477472 335
63 3300010167 Ga0123353_10578024 Ga0123353_105780242 335
64 3300010167 Ga0123353_10790945 Ga0123353_107909452 335
65 3300042603 Ga0466714_085086 Ga0466714_085086_1102_2109 335
66 3300042608 Ga0466721_312619 Ga0466721_312619_79_1086 335
67 3300042635 Ga0466702_023793 Ga0466702_023793_50_1057 335
68 3300042635 Ga0466702_203097 Ga0466702_203097_358_1365 335
69 3300042635 Ga0466702_226122 Ga0466702_226122_21_1028 335
70 iso_pr_bacteria 2820342392 2820342534 335
71 iso_pr_bacteria 2820533259 2820533476 335
72 iso_pr_bacteria 2820573558 2820575134 335
73 3300009826 Ga0123355_10239339 Ga0123355_102393392 336
74 3300010049 Ga0123356_10012128 Ga0123356_100121287 336
75 3300010167 Ga0123353_10083554 Ga0123353_100835545 336
76 3300010167 Ga0123353_10124815 Ga0123353_101248153 336
77 3300042600 Ga0466700_458164 Ga0466700_458164_201_1211 336
78 3300042618 Ga0466723_013393 Ga0466723_013393_683_1720 336
79 iso_pr_bacteria 2576861701 2579271561 336
80 3300002449 JGI24698J34947_10000732 JGI24698J34947_1000073213 337
81 3300009826 Ga0123355_10411785 Ga0123355_104117852 337
82 3300010167 Ga0123353_10058682 Ga0123353_100586822 337
83 3300010167 Ga0123353_10069877 Ga0123353_100698772 337
84 3300042605 Ga0466716_116860 Ga0466716_116860_1416_2429 337
85 3300042606 Ga0466719_210745 Ga0466719_210745_270_1283 337
86 3300042615 Ga0466711_282344 Ga0466711_282344_361_1374 337
87 3300042616 Ga0466715_289164 Ga0466715_289164_61224_62237 337
88 iso_pr_bacteria 2820522177 2820522358 337
89 3300002449 JGI24698J34947_10004552 JGI24698J34947_100045527 338
90 3300002449 JGI24698J34947_10014545 JGI24698J34947_100145454 338
91 3300009784 Ga0123357_10090587 Ga0123357_100905871 338
92 3300010049 Ga0123356_10097762 Ga0123356_100977622 338
93 3300010049 Ga0123356_10318568 Ga0123356_103185682 338
94 3300042601 Ga0466707_239677 Ga0466707_239677_2360_3376 338
95 3300042610 Ga0466698_511050 Ga0466698_511050_439_1455 338
96 3300042612 Ga0466705_222541 Ga0466705_222541_1248_2264 338
97 3300042615 Ga0466711_264041 Ga0466711_264041_30741_31757 338
98 3300042624 Ga0466735_101938 Ga0466735_101938_186_1202 338
99 3300042636 Ga0466703_216350 Ga0466703_216350_6838_7854 338
100 3300010049 Ga0123356_10125440 Ga0123356_101254402 339
101 3300042594 Ga0466694_185965 Ga0466694_185965_417_1436 339
102 3300009826 Ga0123355_10038271 Ga0123355_100382713 340
103 3300042599 Ga0466706_092384 Ga0466706_092384_3724_4746 340
104 3300042611 Ga0466697_179208 Ga0466697_179208_1260_2282 340
105 3300042643 Ga0466704_318960 Ga0466704_318960_1251_2273 340
106 3300042635 Ga0466702_091917 Ga0466702_091917_236_1261 341
107 3300009826 Ga0123355_10002373 Ga0123355_100023736 342
108 3300010049 Ga0123356_10019091 Ga0123356_100190915 342
109 3300042615 Ga0466711_248273 Ga0466711_248273_13908_14945 345
110 3300042652 Ga0466708_211425 Ga0466708_211425_30982_32019 345
111 iso_pr_bacteria 2820442516 2820444325 345
112 iso_pr_bacteria 2820442516 2820444344 345
113 3300009826 Ga0123355_10009182 Ga0123355_100091825 346
114 3300010049 Ga0123356_10016314 Ga0123356_100163144 346
115 3300010167 Ga0123353_10001677 Ga0123353_100016772 346
116 iso_pr_bacteria 2820623020 2820624160 346
117 3300009826 Ga0123355_10000375 Ga0123355_1000037539 347
118 3300010049 Ga0123356_10017637 Ga0123356_100176375 347
119 3300010049 Ga0123356_10000487 Ga0123356_1000048716 349
120 3300042619 Ga0466726_031252 Ga0466726_031252_199_1251 350
121 3300010049 Ga0123356_10028154 Ga0123356_100281543 353
122 3300010049 Ga0123356_10000074 Ga0123356_1000007470 354
123 3300010049 Ga0123356_10003892 Ga0123356_1000389211 354
124 3300010049 Ga0123356_10047908 Ga0123356_100479082 354
125 3300042608 Ga0466721_023587 Ga0466721_023587_1341_2405 354
126 3300042616 Ga0466715_078925 Ga0466715_078925_28570_29634 354
127 3300010049 Ga0123356_10015181 Ga0123356_100151812 355
128 3300010049 Ga0123356_10067686 Ga0123356_100676862 355
129 3300010049 Ga0123356_10143243 Ga0123356_101432432 355
130 3300010167 Ga0123353_10301588 Ga0123353_103015882 355
131 3300010167 Ga0123353_10653795 Ga0123353_106537952 355
132 3300009826 Ga0123355_10049324 Ga0123355_100493243 356
133 3300009826 Ga0123355_10000031 Ga0123355_1000003138 358
134 3300010049 Ga0123356_10401227 Ga0123356_104012271 360
135 3300038395 Ga0415639_007854 Ga0415639_007854_23200_24288 362
136 3300042597 Ga0466699_290333 Ga0466699_290333_63_1151 362
137 3300002450 JGI24695J34938_10000068 JGI24695J34938_1000006852 363
138 3300009826 Ga0123355_10000252 Ga0123355_1000025219 364
139 3300010049 Ga0123356_10173156 Ga0123356_101731562 369
140 iso_pr_bacteria 2820587002 2820588235 369
141 3300010049 Ga0123356_10041174 Ga0123356_100411742 371
142 3300010167 Ga0123353_10362549 Ga0123353_103625492 371
143 3300010167 Ga0123353_10746148 Ga0123353_107461481 371
144 iso_pr_bacteria 2820661146 2820662198 377
145 iso_pr_bacteria 2820690275 2820691204 377
146 3300002450 JGI24695J34938_10001052 JGI24695J34938_1000105217 378
147 3300009826 Ga0123355_10000608 Ga0123355_100006085 380
148 iso_pr_bacteria 2820666966 2820667648 380
149 3300010167 Ga0123353_10031955 Ga0123353_100319556 381
150 3300009826 Ga0123355_10017524 Ga0123355_100175247 396

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 186 390 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.