Protein Family IF02336
Metagenome
Isolate
150
Members
63
Samples
135
Scaffolds
245.77
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10004058|Ga0123355_1000405815
- Length
- 272 aa
- Sequence
- MKQAQKFGGDWTVEKLNILSKKGGAEMRNTKIEWTDQTWNPVTGCTKLSTGCTHCYAEIMAKRLNAMGVYKYANGFTPTIHNNVLDEPLKWRNSHTVFVCSMADLFHDSVPFDFIDKVMSTIQQTKHHRYQILTKRAERMAEYFSQAEIPTNVWLGVTVESSSEKFRIDSLRRLQAAIRFISCEPLINDLEILDLEGIDWIIVGGESGVKARPMKPEWVRTIQQQAREQGVAFFFKQWGTWGSDGVKRNKKANGKALDGKIIQMMPQLAMR*
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.5%
Unclassified
23.0%
Kalotermitidae
18.0%
Passalidae
3.3%
Termopsidae
3.3%
Rhinotermitidae
1.6%
Hodotermitidae
1.6%
Blattidae
1.6%
Taxonomy
Archaea
5
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 12 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 2772190996 | Unclassified Bathyarchaeota Lab288P4bin61 | Isolate | Unclassified |
| 15 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 38 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 44 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 45 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 46 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 51 | 2772190994 | Unclassified Bathyarchaeota Lab288P3bin169 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 59 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 60 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_195584 | 3300042611 | Unclassified | 2597 |
| 2 | 2227307760 | 2225789004 | Bacteria | 1210 |
| 3 | JGI24698J34947_10021801 | 3300002449 | Bacteria | 3442 |
| 4 | Ga0466731_030101 | 3300042622 | Bacteria | 4028 |
| 5 | Ga0466703_193358 | 3300042636 | Bacteria | 35327 |
| 6 | Ga0466709_301568 | 3300042648 | Bacteria | 11872 |
| 7 | Ga0466712_029655 | 3300042614 | Bacteria | 1274 |
| 8 | Ga0466715_319657 | 3300042616 | Bacteria | 1862 |
| 9 | Ga0466718_047982 | 3300042617 | Bacteria | 1918 |
| 10 | Ga0466723_009288 | 3300042618 | Bacteria | 5643 |
| 11 | Ga0466717_220920 | 3300042604 | Unclassified | 1098 |
| 12 | Ga0466716_042851 | 3300042605 | Bacteria | 3011 |
| 13 | Ga0123355_10047879 | 3300009826 | Bacteria | 6949 |
| 14 | Ga0123355_10336782 | 3300009826 | Bacteria | 2014 |
| 15 | Ga0123356_10279743 | 3300010049 | Bacteria | 1763 |
| 16 | Ga0123356_11287012 | 3300010049 | Bacteria | 895 |
| 17 | Ga0123353_10525927 | 3300010167 | Bacteria | 1714 |
| 18 | Ga0123354_10000343 | 3300010882 | Unclassified | 43571 |
| 19 | Ga0123354_10102711 | 3300010882 | Bacteria | 3850 |
| 20 | Ga0466692_080399 | 3300042591 | Bacteria | 16023 |
| 21 | IMNBL1DRAFT_c0015283 | 3300000062 | Bacteria | 3336 |
| 22 | JGI24695J34938_10074669 | 3300002450 | Unclassified | 1410 |
| 23 | JGI24700J35501_10930872 | 3300002508 | Bacteria | 31025 |
| 24 | Ga0466703_086265 | 3300042636 | Bacteria | 1261 |
| 25 | Ga0466709_259893 | 3300042648 | Bacteria | 1359 |
| 26 | Ga0466725_235291 | 3300042654 | Bacteria | 2082 |
| 27 | Ga0466727_148952 | 3300042655 | Bacteria | 1590 |
| 28 | Ga0466706_117702 | 3300042599 | Bacteria | 16236 |
| 29 | Ga0466720_133386 | 3300042607 | Bacteria | 3656 |
| 30 | Ga0123355_10008412 | 3300009826 | Bacteria | 15591 |
| 31 | Ga0123355_10151495 | 3300009826 | Bacteria | 3522 |
| 32 | Ga0123356_10189026 | 3300010049 | Bacteria | 2088 |
| 33 | Ga0123356_10387898 | 3300010049 | Bacteria | 1531 |
| 34 | Ga0466694_316199 | 3300042594 | Bacteria | 10269 |
| 35 | Ga0466705_364679 | 3300042612 | Bacteria | 32665 |
| 36 | Ga0466732_278978 | 3300042656 | Bacteria | 14663 |
| 37 | JGI24702J35022_10100855 | 3300002462 | Bacteria | 1580 |
| 38 | JGI24702J35022_10118477 | 3300002462 | Bacteria | 1461 |
| 39 | JGI24703J35330_11676238 | 3300002501 | Unclassified | 1769 |
| 40 | Ga0072941_1213963 | 3300005201 | Bacteria | 4026 |
| 41 | Ga0466735_129185 | 3300042624 | Bacteria | 2508 |
| 42 | Ga0466703_035552 | 3300042636 | Bacteria | 5632 |
| 43 | Ga0466703_111712 | 3300042636 | Unclassified | 3240 |
| 44 | Ga0466703_279988 | 3300042636 | Bacteria | 4074 |
| 45 | Ga0466703_410786 | 3300042636 | Unclassified | 2593 |
| 46 | Ga0466712_130239 | 3300042614 | Bacteria | 4976 |
| 47 | Ga0466711_360176 | 3300042615 | Bacteria | 4563 |
| 48 | Ga0466728_367639 | 3300042620 | Bacteria | 1166 |
| 49 | Ga0466697_012780 | 3300042611 | Bacteria | 11238 |
| 50 | Ga0123355_10277580 | 3300009826 | Bacteria | 2318 |
| 51 | Ga0123353_10000190 | 3300010167 | Archaea | 77793 |
| 52 | Ga0123353_10382477 | 3300010167 | Bacteria | 2104 |
| 53 | JGI24698J34947_10005074 | 3300002449 | Bacteria | 7211 |
| 54 | JGI24702J35022_10033740 | 3300002462 | Bacteria | 2737 |
| 55 | JGI24702J35022_10095140 | 3300002462 | Unclassified | 1625 |
| 56 | Ga0072941_1003715 | 3300005201 | Bacteria | 18866 |
| 57 | Ga0072941_1085876 | 3300005201 | Archaea | 7088 |
| 58 | Ga0466725_448120 | 3300042654 | Bacteria | 2510 |
| 59 | Ga0466711_266291 | 3300042615 | Bacteria | 103689 |
| 60 | Ga0466711_368532 | 3300042615 | Bacteria | 2159 |
| 61 | Ga0466715_265664 | 3300042616 | Bacteria | 19225 |
| 62 | Ga0466723_080847 | 3300042618 | Bacteria | 56626 |
| 63 | Ga0466723_191113 | 3300042618 | Bacteria | 4309 |
| 64 | Ga0466706_108683 | 3300042599 | Bacteria | 5018 |
| 65 | Ga0466706_130687 | 3300042599 | Bacteria | 1233 |
| 66 | Ga0466720_051386 | 3300042607 | Bacteria | 6410 |
| 67 | Ga0123357_10506564 | 3300009784 | Bacteria | 998 |
| 68 | Ga0123356_10529036 | 3300010049 | Unclassified | 1338 |
| 69 | Ga0123353_10000387 | 3300010167 | Bacteria | 53967 |
| 70 | Ga0123353_10051884 | 3300010167 | Bacteria | 6546 |
| 71 | Ga0264413_110012 | 3300024493 | Unclassified | 2632 |
| 72 | Ga0415639_194236 | 3300038395 | Bacteria | 1566 |
| 73 | Ga0466693_257289 | 3300042592 | Bacteria | 2035 |
| 74 | Ga0466696_293299 | 3300042596 | Bacteria | 2615 |
| 75 | Ga0466699_340101 | 3300042597 | Bacteria | 7036 |
| 76 | Ga0466732_408115 | 3300042656 | Unclassified | 1189 |
| 77 | JGI24698J34947_10012908 | 3300002449 | Bacteria | 4565 |
| 78 | JGI24699J35502_11062413 | 3300002509 | Unclassified | 1754 |
| 79 | Ga0072941_1063167 | 3300005201 | Bacteria | 11204 |
| 80 | Ga0466704_425760 | 3300042643 | Unclassified | 1813 |
| 81 | Ga0466711_312037 | 3300042615 | Bacteria | 19125 |
| 82 | Ga0466711_400267 | 3300042615 | Bacteria | 4656 |
| 83 | Ga0466728_093313 | 3300042620 | Bacteria | 2732 |
| 84 | Ga0123355_10004058 | 3300009826 | Bacteria | 21226 |
| 85 | Ga0123353_10417439 | 3300010167 | Bacteria | 1990 |
| 86 | Ga0264413_142239 | 3300024493 | Bacteria | 2052 |
| 87 | Ga0466690_160604 | 3300042590 | Bacteria | 4774 |
| 88 | Ga0466694_184018 | 3300042594 | Bacteria | 2415 |
| 89 | Ga0466694_227114 | 3300042594 | Bacteria | 2225 |
| 90 | Ga0466696_254441 | 3300042596 | Bacteria | 3940 |
| 91 | Ga0466697_141790 | 3300042611 | Bacteria | 2197 |
| 92 | Ga0466705_103579 | 3300042612 | Bacteria | 1956 |
| 93 | IMNBL1DRAFT_c0007118 | 3300000062 | Bacteria | 5950 |
| 94 | JGI24695J34938_10036069 | 3300002450 | Bacteria | 2257 |
| 95 | JGI24702J35022_10012770 | 3300002462 | Bacteria | 4662 |
| 96 | JGI24703J35330_11737844 | 3300002501 | Bacteria | 3146 |
| 97 | JGI24700J35501_10930749 | 3300002508 | Bacteria | 21637 |
| 98 | Ga0072941_1004402 | 3300005201 | Bacteria | 8458 |
| 99 | Ga0072941_1048181 | 3300005201 | Bacteria | 7251 |
| 100 | Ga0466703_112455 | 3300042636 | Bacteria | 9603 |
| 101 | Ga0466727_090492 | 3300042655 | Bacteria | 3587 |
| 102 | Ga0466718_002819 | 3300042617 | Bacteria | 3255 |
| 103 | Ga0466700_259716 | 3300042600 | Bacteria | 3277 |
| 104 | Ga0466714_033447 | 3300042603 | Bacteria | 1684 |
| 105 | Ga0466717_014555 | 3300042604 | Bacteria | 26810 |
| 106 | Ga0123355_10122283 | 3300009826 | Bacteria | 4034 |
| 107 | Ga0123356_10081340 | 3300010049 | Bacteria | 3064 |
| 108 | Ga0123356_10271845 | 3300010049 | Bacteria | 1785 |
| 109 | Ga0123354_10602295 | 3300010882 | Unclassified | 804 |
| 110 | Ga0415639_025067 | 3300038395 | Bacteria | 2193 |
| 111 | JGI24700J35501_10927361 | 3300002508 | Bacteria | 6769 |
| 112 | JGI24696J40584_12842428 | 3300002834 | Unclassified | 958 |
| 113 | Ga0466704_365887 | 3300042643 | Bacteria | 1146 |
| 114 | Ga0466727_045262 | 3300042655 | Bacteria | 17200 |
| 115 | Ga0466715_557542 | 3300042616 | Bacteria | 2741 |
| 116 | Ga0466723_314786 | 3300042618 | Bacteria | 14217 |
| 117 | Ga0466720_184659 | 3300042607 | Bacteria | 1984 |
| 118 | Ga0123357_10289217 | 3300009784 | Bacteria | 1677 |
| 119 | Ga0123356_10478488 | 3300010049 | Unclassified | 1398 |
| 120 | Ga0123356_10692056 | 3300010049 | Bacteria | 1188 |
| 121 | Ga0123353_10043835 | 3300010167 | Bacteria | 7089 |
| 122 | Ga0466696_253705 | 3300042596 | Bacteria | 2365 |
| 123 | AustNasuHG_c1002188 | 3300000089 | Bacteria | 7063 |
| 124 | JGI24696J40584_12960309 | 3300002834 | Bacteria | 6878 |
| 125 | Ga0466702_056448 | 3300042635 | Bacteria | 4854 |
| 126 | Ga0466712_053205 | 3300042614 | Bacteria | 2876 |
| 127 | Ga0466718_023251 | 3300042617 | Bacteria | 9935 |
| 128 | Ga0466718_089300 | 3300042617 | Bacteria | 1469 |
| 129 | Ga0466728_198399 | 3300042620 | Bacteria | 23860 |
| 130 | Ga0466707_133640 | 3300042601 | Bacteria | 2193 |
| 131 | Ga0466714_018500 | 3300042603 | Bacteria | 2565 |
| 132 | Ga0466721_126958 | 3300042608 | Bacteria | 9090 |
| 133 | Ga0123355_10073506 | 3300009826 | Bacteria | 5479 |
| 134 | Ga0123355_10149603 | 3300009826 | Bacteria | 3550 |
| 135 | Ga0466690_010902 | 3300042590 | Bacteria | 1217 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07505 | DUF5131 | Protein of unknown function (DUF5131) | 29 | 266 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.