Protein Family IF02329
Metagenome
Metatranscriptome
Isolate
252
Members
87
Samples
222
Scaffolds
92.46
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10003269|Ga0123355_1000326927
- Length
- 88 aa
- Sequence
- VGRSVKKGPFVAPVLLKRVREMNKVLKTWSRASTIFPDFVGHTFAVHDGRKHVPVYVTEDMVGHKLGEFAPTRTYRGHAGSKKSGSK*
Sample Types
Isolate
11.9%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.0%
Unclassified
34.9%
Kalotermitidae
11.6%
Tenebrionidae
4.7%
Passalidae
3.5%
Termopsidae
3.5%
Rhinotermitidae
2.3%
Hodotermitidae
1.2%
Cryptocercidae
1.2%
Apidae
1.2%
Taxonomy
Archaea
0
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 4 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 5 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 6 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 7 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 10 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 11 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 12 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 15 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 16 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 17 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010053 | Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA | Metagenome | Cryptocercidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 31 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 32 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 42 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 43 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 44 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 54 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 55 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 61 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 62 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 63 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 64 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 70 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 71 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 72 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 73 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 74 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 75 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 76 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 77 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 78 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 79 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 80 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 81 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 82 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 83 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 84 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 85 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 86 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 87 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_208196 | 3300042659 | Bacteria | 4777 |
| 2 | Ga0466692_026254 | 3300042591 | Bacteria | 97091 |
| 3 | Ga0466696_231535 | 3300042596 | Bacteria | 8719 |
| 4 | Ga0123356_10283289 | 3300010049 | Bacteria | 1754 |
| 5 | Ga0123356_13525326 | 3300010049 | Bacteria | 542 |
| 6 | Ga0123353_10007664 | 3300010167 | Bacteria | 14629 |
| 7 | Ga0123353_10048563 | 3300010167 | Bacteria | 6757 |
| 8 | Ga0123353_10458049 | 3300010167 | Bacteria | 1875 |
| 9 | Ga0123354_10628430 | 3300010882 | Bacteria | 775 |
| 10 | Ga0466734_082412 | 3300042623 | Bacteria | 1629 |
| 11 | Ga0466702_323939 | 3300042635 | Bacteria | 1921 |
| 12 | Ga0466703_168474 | 3300042636 | Bacteria | 32420 |
| 13 | Ga0466703_190990 | 3300042636 | Bacteria | 1926 |
| 14 | Ga0466704_333763 | 3300042643 | Bacteria | 67469 |
| 15 | Ga0466706_181444 | 3300042599 | Bacteria | 2239 |
| 16 | Ga0466706_266989 | 3300042599 | Unclassified | 1512 |
| 17 | Ga0466714_145920 | 3300042603 | Bacteria | 2081 |
| 18 | Ga0466698_011576 | 3300042610 | Bacteria | 51802 |
| 19 | 2227265812 | 2225789004 | Bacteria | 1289 |
| 20 | JGI24702J35022_10325771 | 3300002462 | Unclassified | 912 |
| 21 | Ga0415639_001376 | 3300038395 | Bacteria | 30789 |
| 22 | Ga0415639_006405 | 3300038395 | Bacteria | 33378 |
| 23 | Ga0415639_019174 | 3300038395 | Bacteria | 27021 |
| 24 | Ga0466690_217090 | 3300042590 | Bacteria | 43815 |
| 25 | Ga0123355_11349843 | 3300009826 | Bacteria | 710 |
| 26 | Ga0123355_11632233 | 3300009826 | Bacteria | 619 |
| 27 | Ga0123356_10088961 | 3300010049 | Bacteria | 2937 |
| 28 | Ga0123356_13739186 | 3300010049 | Bacteria | 526 |
| 29 | Ga0123353_12987015 | 3300010167 | Bacteria | 548 |
| 30 | Ga0123353_13164917 | 3300010167 | Bacteria | 528 |
| 31 | Ga0466704_241474 | 3300042643 | Bacteria | 23689 |
| 32 | Ga0466706_039645 | 3300042599 | Bacteria | 5088 |
| 33 | Ga0466706_118451 | 3300042599 | Bacteria | 3065 |
| 34 | Ga0466706_159452 | 3300042599 | Bacteria | 89359 |
| 35 | Ga0466706_162915 | 3300042599 | Bacteria | 17654 |
| 36 | Ga0466707_304816 | 3300042601 | Bacteria | 21280 |
| 37 | Ga0466717_056838 | 3300042604 | Bacteria | 1241 |
| 38 | IMNBGM34_c000305 | 3300000036 | Bacteria | 14046 |
| 39 | JGI24695J34938_10022198 | 3300002450 | Bacteria | 3088 |
| 40 | JGI24700J35501_10282524 | 3300002508 | Bacteria | 593 |
| 41 | Ga0072940_1041284 | 3300005200 | Bacteria | 3132 |
| 42 | Ga0466715_162043 | 3300042616 | Bacteria | 36555 |
| 43 | Ga0466718_033987 | 3300042617 | Bacteria | 1405 |
| 44 | Ga0466723_157225 | 3300042618 | Bacteria | 18330 |
| 45 | Ga0123355_10003975 | 3300009826 | Bacteria | 21402 |
| 46 | Ga0123355_10012398 | 3300009826 | Bacteria | 13202 |
| 47 | Ga0123356_10013255 | 3300010049 | Bacteria | 7967 |
| 48 | Ga0123356_10055527 | 3300010049 | Bacteria | 3689 |
| 49 | Ga0123356_11325120 | 3300010049 | Bacteria | 883 |
| 50 | Ga0123353_10351766 | 3300010167 | Bacteria | 2219 |
| 51 | Ga0466703_190061 | 3300042636 | Bacteria | 90552 |
| 52 | Ga0466706_066717 | 3300042599 | Bacteria | 1447 |
| 53 | Ga0466706_247780 | 3300042599 | Bacteria | 4451 |
| 54 | Ga0466707_262676 | 3300042601 | Bacteria | 90434 |
| 55 | Ga0466714_094371 | 3300042603 | Bacteria | 1973 |
| 56 | Ga0466719_373723 | 3300042606 | Bacteria | 19766 |
| 57 | FGTW_GHW66OE02HJ6FJ | 2065487013 | Bacteria | 521 |
| 58 | IMNBL1DRAFT_c0193480 | 3300000062 | Bacteria | 511 |
| 59 | JGI24702J35022_10057765 | 3300002462 | Bacteria | 2072 |
| 60 | Ga0466705_191850 | 3300042612 | Bacteria | 69130 |
| 61 | Ga0466732_260139 | 3300042656 | Bacteria | 1505 |
| 62 | Ga0466733_204061 | 3300042659 | Bacteria | 1677 |
| 63 | Ga0562376_3916 | 3300056857 | Unclassified | 13797 |
| 64 | Ga0466705_395886 | 3300042612 | Bacteria | 2728 |
| 65 | Ga0466712_188541 | 3300042614 | Bacteria | 1478 |
| 66 | Ga0466723_105077 | 3300042618 | Bacteria | 12253 |
| 67 | Ga0233288_1011838 | 3300022232 | Unclassified | 1794 |
| 68 | Ga0415639_006839 | 3300038395 | Bacteria | 2707 |
| 69 | Ga0415639_120996 | 3300038395 | Bacteria | 1134 |
| 70 | Ga0415639_121180 | 3300038395 | Bacteria | 3675 |
| 71 | Ga0123357_10124827 | 3300009784 | Bacteria | 3229 |
| 72 | Ga0123355_10002185 | 3300009826 | Bacteria | 27609 |
| 73 | Ga0123355_10085394 | 3300009826 | Bacteria | 5023 |
| 74 | Ga0123355_11761043 | 3300009826 | Bacteria | 587 |
| 75 | Ga0123356_10139089 | 3300010049 | Bacteria | 2393 |
| 76 | Ga0123356_10436021 | 3300010049 | Bacteria | 1455 |
| 77 | Ga0123356_10669469 | 3300010049 | Unclassified | 1206 |
| 78 | Ga0123356_13030043 | 3300010049 | Bacteria | 586 |
| 79 | Ga0123353_10006061 | 3300010167 | Bacteria | 16024 |
| 80 | Ga0123353_10012761 | 3300010167 | Bacteria | 11980 |
| 81 | Ga0123353_10095236 | 3300010167 | Bacteria | 4797 |
| 82 | Ga0123353_10638118 | 3300010167 | Bacteria | 1511 |
| 83 | Ga0123353_12109233 | 3300010167 | Bacteria | 686 |
| 84 | Ga0466731_109580 | 3300042622 | Bacteria | 2509 |
| 85 | Ga0466703_248740 | 3300042636 | Bacteria | 29648 |
| 86 | Ga0466706_006486 | 3300042599 | Bacteria | 3315 |
| 87 | Ga0466707_254889 | 3300042601 | Bacteria | 95649 |
| 88 | Ga0466714_056846 | 3300042603 | Bacteria | 2316 |
| 89 | Ga0466717_305116 | 3300042604 | Bacteria | 1433 |
| 90 | Ga0466721_015423 | 3300042608 | Bacteria | 14106 |
| 91 | Ga0466721_057110 | 3300042608 | Bacteria | 1746 |
| 92 | 2227494078 | 2225789004 | Bacteria | 20130 |
| 93 | Ga0466733_215673 | 3300042659 | Bacteria | 10596 |
| 94 | Ga0562374_3245 | 3300057007 | Bacteria | 9974 |
| 95 | Ga0466715_155843 | 3300042616 | Bacteria | 19455 |
| 96 | Ga0415639_003419 | 3300038395 | Bacteria | 52955 |
| 97 | Ga0415639_063203 | 3300038395 | Bacteria | 3101 |
| 98 | Ga0466696_293988 | 3300042596 | Bacteria | 4873 |
| 99 | Ga0466699_048685 | 3300042597 | Unclassified | 1764 |
| 100 | Ga0123357_10507639 | 3300009784 | Unclassified | 996 |
| 101 | Ga0123355_10287847 | 3300009826 | Unclassified | 2259 |
| 102 | Ga0123355_10312273 | 3300009826 | Bacteria | 2129 |
| 103 | Ga0123356_10443850 | 3300010049 | Bacteria | 1444 |
| 104 | Ga0123353_10277339 | 3300010167 | Bacteria | 2578 |
| 105 | Ga0123353_12248958 | 3300010167 | Bacteria | 658 |
| 106 | Ga0123354_10174416 | 3300010882 | Bacteria | 2485 |
| 107 | Ga0466735_158867 | 3300042624 | Bacteria | 1983 |
| 108 | Ga0466730_051940 | 3300042625 | Bacteria | 1148 |
| 109 | Ga0466706_073285 | 3300042599 | Bacteria | 3125 |
| 110 | Ga0466706_092147 | 3300042599 | Bacteria | 1302 |
| 111 | Ga0466706_120384 | 3300042599 | Unclassified | 4942 |
| 112 | Ga0466700_289228 | 3300042600 | Bacteria | 1086 |
| 113 | Ga0466700_316608 | 3300042600 | Bacteria | 72668 |
| 114 | Ga0466707_248131 | 3300042601 | Bacteria | 12640 |
| 115 | Ga0466707_329910 | 3300042601 | Bacteria | 3613 |
| 116 | Ga0466714_054038 | 3300042603 | Bacteria | 15975 |
| 117 | Ga0466714_083698 | 3300042603 | Bacteria | 3341 |
| 118 | Ga0466714_112537 | 3300042603 | Bacteria | 1371 |
| 119 | Ga0466716_543606 | 3300042605 | Bacteria | 1728 |
| 120 | Ga0466722_206927 | 3300042609 | Bacteria | 1181 |
| 121 | 2227469098 | 2225789004 | Bacteria | 4980 |
| 122 | 2227516186 | 2225789004 | Bacteria | 680 |
| 123 | JGI24702J35022_10742141 | 3300002462 | Unclassified | 611 |
| 124 | JGI24703J35330_11748856 | 3300002501 | Bacteria | 55836 |
| 125 | Ga0068305_10005402 | 3300005083 | Bacteria | 29409 |
| 126 | Ga0466733_165227 | 3300042659 | Bacteria | 1456 |
| 127 | Ga0466710_444423 | 3300042613 | Unclassified | 1813 |
| 128 | Ga0466718_069623 | 3300042617 | Bacteria | 5651 |
| 129 | Ga0415639_020026 | 3300038395 | Bacteria | 4220 |
| 130 | Ga0415639_042237 | 3300038395 | Bacteria | 3821 |
| 131 | Ga0415639_078077 | 3300038395 | Bacteria | 2804 |
| 132 | Ga0415639_093101 | 3300038395 | Unclassified | 3804 |
| 133 | Ga0466690_067384 | 3300042590 | Bacteria | 43972 |
| 134 | Ga0123355_12120636 | 3300009826 | Unclassified | 516 |
| 135 | Ga0123356_11061176 | 3300010049 | Unclassified | 979 |
| 136 | Ga0123356_11491784 | 3300010049 | Bacteria | 834 |
| 137 | Ga0123356_11589639 | 3300010049 | Bacteria | 809 |
| 138 | Ga0123356_12005595 | 3300010049 | Unclassified | 722 |
| 139 | Ga0123356_13702472 | 3300010049 | Bacteria | 529 |
| 140 | Ga0134290_1360859 | 3300010053 | Bacteria | 556 |
| 141 | Ga0123353_10000294 | 3300010167 | Bacteria | 62045 |
| 142 | Ga0123353_11058336 | 3300010167 | Bacteria | 1083 |
| 143 | Ga0123353_12397867 | 3300010167 | Bacteria | 631 |
| 144 | Ga0466731_262541 | 3300042622 | Unclassified | 1166 |
| 145 | Ga0466703_320837 | 3300042636 | Bacteria | 1065 |
| 146 | Ga0466706_003667 | 3300042599 | Bacteria | 13149 |
| 147 | Ga0466706_084454 | 3300042599 | Bacteria | 2250 |
| 148 | Ga0466706_132556 | 3300042599 | Bacteria | 1868 |
| 149 | Ga0466714_003873 | 3300042603 | Bacteria | 1458 |
| 150 | Ga0466714_056030 | 3300042603 | Unclassified | 1367 |
| 151 | Ga0466698_337884 | 3300042610 | Bacteria | 12427 |
| 152 | IMNBL1DRAFT_c0095314 | 3300000062 | Bacteria | 809 |
| 153 | AustNasuHG_c1000039 | 3300000089 | Bacteria | 32381 |
| 154 | JGI24698J34947_10106841 | 3300002449 | Unclassified | 1244 |
| 155 | JGI24696J40584_12836888 | 3300002834 | Unclassified | 944 |
| 156 | Ga0072940_1074089 | 3300005200 | Unclassified | 2082 |
| 157 | Ga0466733_005750 | 3300042659 | Bacteria | 6291 |
| 158 | Ga0562378_0068 | 3300056814 | Bacteria | 301904 |
| 159 | Ga0466711_164804 | 3300042615 | Bacteria | 2728 |
| 160 | Ga0466715_584084 | 3300042616 | Bacteria | 48896 |
| 161 | Ga0415639_019702 | 3300038395 | Bacteria | 1422 |
| 162 | Ga0466692_185106 | 3300042591 | Bacteria | 1127 |
| 163 | Ga0466696_243716 | 3300042596 | Bacteria | 2750 |
| 164 | Ga0466696_296748 | 3300042596 | Bacteria | 1050 |
| 165 | Ga0123355_11356157 | 3300009826 | Bacteria | 708 |
| 166 | Ga0123356_10053485 | 3300010049 | Bacteria | 3758 |
| 167 | Ga0123356_11125154 | 3300010049 | Bacteria | 953 |
| 168 | Ga0123356_11125779 | 3300010049 | Bacteria | 953 |
| 169 | Ga0123356_11500570 | 3300010049 | Unclassified | 832 |
| 170 | Ga0123356_12769035 | 3300010049 | Bacteria | 614 |
| 171 | Ga0123353_10005887 | 3300010167 | Bacteria | 16213 |
| 172 | Ga0123353_10348853 | 3300010167 | Bacteria | 2231 |
| 173 | Ga0123353_11151379 | 3300010167 | Bacteria | 1024 |
| 174 | Ga0123353_11707473 | 3300010167 | Bacteria | 788 |
| 175 | Ga0466734_094068 | 3300042623 | Bacteria | 1043 |
| 176 | Ga0466727_263651 | 3300042655 | Unclassified | 1712 |
| 177 | Ga0466706_001609 | 3300042599 | Bacteria | 21964 |
| 178 | Ga0466706_021664 | 3300042599 | Bacteria | 1539 |
| 179 | Ga0466706_115605 | 3300042599 | Bacteria | 5924 |
| 180 | Ga0466714_026042 | 3300042603 | Bacteria | 1244 |
| 181 | Ga0466714_059248 | 3300042603 | Unclassified | 1403 |
| 182 | Ga0466717_018744 | 3300042604 | Unclassified | 1193 |
| 183 | Ga0466719_201247 | 3300042606 | Bacteria | 254275 |
| 184 | IMNBL1DRAFT_c0001208 | 3300000062 | Bacteria | 19538 |
| 185 | IMNBL1DRAFT_c0001977 | 3300000062 | Bacteria | 14765 |
| 186 | JGI24702J35022_10090613 | 3300002462 | Bacteria | 1664 |
| 187 | JGI24702J35022_10510328 | 3300002462 | Bacteria | 738 |
| 188 | Ga0072940_1072310 | 3300005200 | Unclassified | 1082 |
| 189 | Ga0530661_039118 | 3300056564 | Bacteria | 1378 |
| 190 | Ga0562376_0357 | 3300056857 | Bacteria | 87410 |
| 191 | Ga0466705_530187 | 3300042612 | Bacteria | 5092 |
| 192 | Ga0466711_249894 | 3300042615 | Bacteria | 13885 |
| 193 | Ga0466726_143303 | 3300042619 | Bacteria | 13387 |
| 194 | Ga0415639_010939 | 3300038395 | Bacteria | 5492 |
| 195 | Ga0466696_003608 | 3300042596 | Bacteria | 10415 |
| 196 | Ga0123357_10058458 | 3300009784 | Bacteria | 5177 |
| 197 | Ga0123355_10003269 | 3300009826 | Bacteria | 23161 |
| 198 | Ga0123355_10395400 | 3300009826 | Bacteria | 1788 |
| 199 | Ga0123356_10071864 | 3300010049 | Bacteria | 3249 |
| 200 | Ga0123356_10111606 | 3300010049 | Bacteria | 2642 |
| 201 | Ga0123353_10075100 | 3300010167 | Bacteria | 5433 |
| 202 | Ga0123353_10220916 | 3300010167 | Unclassified | 2962 |
| 203 | Ga0123353_11247787 | 3300010167 | Bacteria | 970 |
| 204 | Ga0123353_11761246 | 3300010167 | Bacteria | 772 |
| 205 | Ga0123353_13318615 | 3300010167 | Bacteria | 513 |
| 206 | Ga0123354_10216706 | 3300010882 | Bacteria | 2049 |
| 207 | Ga0123354_10757484 | 3300010882 | Unclassified | 664 |
| 208 | Ga0123354_11109947 | 3300010882 | Bacteria | 501 |
| 209 | Ga0466706_041395 | 3300042599 | Bacteria | 1591 |
| 210 | Ga0466706_059133 | 3300042599 | Bacteria | 3860 |
| 211 | Ga0466706_131609 | 3300042599 | Bacteria | 3121 |
| 212 | Ga0466706_153510 | 3300042599 | Bacteria | 1013 |
| 213 | Ga0466706_194905 | 3300042599 | Bacteria | 5065 |
| 214 | Ga0466717_264649 | 3300042604 | Bacteria | 1316 |
| 215 | Ga0466722_148049 | 3300042609 | Bacteria | 3655 |
| 216 | Ga0466722_149515 | 3300042609 | Bacteria | 1068 |
| 217 | Ga0466722_203062 | 3300042609 | Bacteria | 4828 |
| 218 | 2227191914 | 2225789004 | Bacteria | 33932 |
| 219 | 2227519832 | 2225789004 | Bacteria | 668 |
| 220 | IMNBL1DRAFT_c0026888 | 3300000062 | Bacteria | 2177 |
| 221 | JGI24703J35330_11397801 | 3300002501 | Bacteria | 957 |
| 222 | Ga0068305_10204998 | 3300005083 | Bacteria | 1335 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 3 | 78 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.