Protein Family IF02307
Metagenome
Isolate
261
Members
95
Samples
222
Scaffolds
314.71
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10001464|Ga0123355_1000146414
- Length
- 376 aa
- Sequence
- MLGSSRHANNGNSLFVDIFAIIISHALVTVNHANRFFVLKIFFYFPTGYVKIKTKFNYIRRKITMPLVSSKEMLEKAYAGGYAIGAFNVNNMEIVQGITEAAKELNSPIILQVSAGARKYANHTYLMKLVEAAIEETGLPMALHLDHGDTFELCKSCIDGGFSSVMIDGSHHSFEDNIKLTRQVVEYAHARGVTVEGELGRLAGVEDDVNVSEEDATYTRPEEVEEFVEKTGVDSLAIAIGTSHGAFKFKPGQKPQLRFDILEEISRRVPGFPIVLHGASSVVPEYVKMINDNGGAMDDAIGIPEDMLRKAAGMAVCKINIDSDLRLAMTGTIRQYFTQHPAHFDPRQYLGPGRESVKKVVAHKIKHVLGSEGKL*
Sample Types
Isolate
14.9%
Metagenome
85.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Termitidae
31.2%
Kalotermitidae
12.9%
Blattidae
10.8%
Termopsidae
4.3%
Rhinotermitidae
3.2%
Passalidae
2.2%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
236
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 2 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 3 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 4 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 5 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 6 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 7 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 18 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 19 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 34 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 35 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 36 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 37 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 38 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 52 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 53 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 54 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 61 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 62 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 63 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 64 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 65 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 66 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 67 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 75 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 76 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 77 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 78 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 79 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 80 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 81 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 86 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 87 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 88 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 89 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 90 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 91 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 92 | 2820396902 | Unclassified Firmicutes Nc150P1bin3 | Isolate | Unclassified |
| 93 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 94 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227480177 | 2225789004 | Bacteria | 85772 |
| 2 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 3 | IMNBL1DRAFT_c0016644 | 3300000062 | Bacteria | 3136 |
| 4 | JGI24702J35022_10003519 | 3300002462 | Bacteria | 9429 |
| 5 | Ga0072941_1007794 | 3300005201 | Bacteria | 77894 |
| 6 | Ga0466735_120830 | 3300042624 | Unclassified | 4284 |
| 7 | Ga0466706_268621 | 3300042599 | Bacteria | 2328 |
| 8 | Ga0466714_011334 | 3300042603 | Bacteria | 1261 |
| 9 | Ga0466719_244949 | 3300042606 | Bacteria | 12683 |
| 10 | Ga0466722_126239 | 3300042609 | Bacteria | 1158 |
| 11 | Ga0466698_091188 | 3300042610 | Bacteria | 30334 |
| 12 | Ga0264413_101046 | 3300024493 | Bacteria | 18021 |
| 13 | Ga0466690_221039 | 3300042590 | Bacteria | 17812 |
| 14 | Ga0466691_036465 | 3300042593 | Unclassified | 6707 |
| 15 | Ga0466696_416929 | 3300042596 | Bacteria | 18880 |
| 16 | Ga0123357_10062354 | 3300009784 | Bacteria | 4992 |
| 17 | Ga0123355_10001464 | 3300009826 | Bacteria | 32859 |
| 18 | Ga0123355_10065499 | 3300009826 | Unclassified | 5852 |
| 19 | Ga0123353_10010313 | 3300010167 | Bacteria | 13002 |
| 20 | Ga0123353_10030939 | 3300010167 | Bacteria | 8281 |
| 21 | Ga0123353_10039716 | 3300010167 | Bacteria | 7414 |
| 22 | Ga0123353_10073446 | 3300010167 | Bacteria | 5497 |
| 23 | Ga0123353_10075978 | 3300010167 | Bacteria | 5398 |
| 24 | Ga0123353_10097374 | 3300010167 | Bacteria | 4741 |
| 25 | Ga0123353_10177888 | 3300010167 | Bacteria | 3371 |
| 26 | Ga0123353_10320570 | 3300010167 | Bacteria | 2352 |
| 27 | Ga0123353_10321710 | 3300010167 | Bacteria | 2347 |
| 28 | Ga0123354_10250601 | 3300010882 | Bacteria | 1795 |
| 29 | Ga0466705_036513 | 3300042612 | Bacteria | 122886 |
| 30 | 2227513550 | 2225789004 | Bacteria | 3501 |
| 31 | 2227552409 | 2225789004 | Bacteria | 14913 |
| 32 | IMNBL1DRAFT_c0000401 | 3300000062 | Bacteria | 36916 |
| 33 | JGI24702J35022_10000690 | 3300002462 | Bacteria | 20612 |
| 34 | JGI24702J35022_10088063 | 3300002462 | Bacteria | 1687 |
| 35 | Ga0068305_10043194 | 3300005083 | Bacteria | 24214 |
| 36 | Ga0466729_295823 | 3300042621 | Unclassified | 4051 |
| 37 | Ga0466735_048898 | 3300042624 | Bacteria | 2122 |
| 38 | Ga0466706_201093 | 3300042599 | Bacteria | 7074 |
| 39 | Ga0466700_079534 | 3300042600 | Bacteria | 1974 |
| 40 | Ga0466700_349250 | 3300042600 | Bacteria | 1828 |
| 41 | Ga0466714_097476 | 3300042603 | Bacteria | 1934 |
| 42 | Ga0466716_457853 | 3300042605 | Bacteria | 5045 |
| 43 | Ga0466720_219993 | 3300042607 | Bacteria | 1463 |
| 44 | Ga0415639_102275 | 3300038395 | Unclassified | 7887 |
| 45 | Ga0466692_027120 | 3300042591 | Bacteria | 14828 |
| 46 | Ga0466692_036632 | 3300042591 | Unclassified | 2004 |
| 47 | Ga0466691_027968 | 3300042593 | Bacteria | 11390 |
| 48 | Ga0466696_235395 | 3300042596 | Unclassified | 8177 |
| 49 | Ga0466699_227345 | 3300042597 | Bacteria | 4375 |
| 50 | Ga0466710_413375 | 3300042613 | Bacteria | 2139 |
| 51 | Ga0466715_142490 | 3300042616 | Bacteria | 66178 |
| 52 | Ga0466723_180857 | 3300042618 | Bacteria | 75146 |
| 53 | Ga0123355_10020544 | 3300009826 | Bacteria | 10551 |
| 54 | Ga0123355_10113656 | 3300009826 | Bacteria | 4222 |
| 55 | Ga0123355_10323837 | 3300009826 | Bacteria | 2073 |
| 56 | Ga0123356_10010803 | 3300010049 | Bacteria | 8930 |
| 57 | Ga0123356_10095200 | 3300010049 | Bacteria | 2846 |
| 58 | Ga0123356_10107960 | 3300010049 | Bacteria | 2683 |
| 59 | Ga0123356_10357542 | 3300010049 | Bacteria | 1586 |
| 60 | Ga0123353_10054889 | 3300010167 | Bacteria | 6372 |
| 61 | Ga0123353_10100304 | 3300010167 | Bacteria | 4666 |
| 62 | Ga0123353_10124717 | 3300010167 | Bacteria | 4139 |
| 63 | Ga0123353_10284151 | 3300010167 | Bacteria | 2538 |
| 64 | Ga0123353_10331056 | 3300010167 | Bacteria | 2305 |
| 65 | Ga0123354_10075197 | 3300010882 | Bacteria | 4832 |
| 66 | Ga0123354_10252692 | 3300010882 | Unclassified | 1781 |
| 67 | Ga0123354_10256873 | 3300010882 | Bacteria | 1755 |
| 68 | Ga0466705_179868 | 3300042612 | Bacteria | 2034 |
| 69 | Ga0466733_030410 | 3300042659 | Bacteria | 3285 |
| 70 | Ga0466733_072386 | 3300042659 | Bacteria | 8701 |
| 71 | IMNBL1DRAFT_c0001634 | 3300000062 | Bacteria | 16589 |
| 72 | IMNBL1DRAFT_c0022908 | 3300000062 | Unclassified | 2459 |
| 73 | JGI24698J34947_10019068 | 3300002449 | Bacteria | 3704 |
| 74 | Ga0466729_207702 | 3300042621 | Bacteria | 2198 |
| 75 | Ga0466735_101049 | 3300042624 | Bacteria | 3685 |
| 76 | Ga0466702_070425 | 3300042635 | Bacteria | 43516 |
| 77 | Ga0466703_004248 | 3300042636 | Bacteria | 4618 |
| 78 | Ga0466706_281790 | 3300042599 | Bacteria | 1388 |
| 79 | Ga0466700_406579 | 3300042600 | Bacteria | 15325 |
| 80 | Ga0466707_076572 | 3300042601 | Bacteria | 5742 |
| 81 | Ga0466707_213247 | 3300042601 | Bacteria | 1710 |
| 82 | Ga0466714_115362 | 3300042603 | Bacteria | 9239 |
| 83 | Ga0466721_094125 | 3300042608 | Bacteria | 3974 |
| 84 | Ga0466698_392140 | 3300042610 | Bacteria | 2059 |
| 85 | Ga0466697_028138 | 3300042611 | Bacteria | 1027 |
| 86 | Ga0415639_015027 | 3300038395 | Bacteria | 40626 |
| 87 | Ga0415639_047794 | 3300038395 | Bacteria | 9783 |
| 88 | Ga0466693_224594 | 3300042592 | Bacteria | 2650 |
| 89 | Ga0466693_228010 | 3300042592 | Bacteria | 2220 |
| 90 | Ga0466712_318958 | 3300042614 | Bacteria | 2423 |
| 91 | Ga0466711_050419 | 3300042615 | Bacteria | 2342 |
| 92 | Ga0466726_106223 | 3300042619 | Bacteria | 25972 |
| 93 | Ga0466726_176702 | 3300042619 | Bacteria | 18406 |
| 94 | Ga0123357_10095727 | 3300009784 | Unclassified | 3848 |
| 95 | Ga0123355_10001466 | 3300009826 | Bacteria | 32817 |
| 96 | Ga0123356_10009761 | 3300010049 | Bacteria | 9462 |
| 97 | Ga0123356_10459138 | 3300010049 | Bacteria | 1423 |
| 98 | Ga0123353_10084715 | 3300010167 | Bacteria | 5103 |
| 99 | Ga0123353_10194838 | 3300010167 | Bacteria | 3195 |
| 100 | Ga0466733_221648 | 3300042659 | Unclassified | 10890 |
| 101 | Ga0466727_002657 | 3300042655 | Bacteria | 4054 |
| 102 | Ga0466700_081675 | 3300042600 | Bacteria | 3152 |
| 103 | Ga0466713_072041 | 3300042602 | Bacteria | 94552 |
| 104 | Ga0466713_082373 | 3300042602 | Bacteria | 18425 |
| 105 | Ga0264413_111806 | 3300024493 | Bacteria | 18132 |
| 106 | Ga0466690_025455 | 3300042590 | Bacteria | 10416 |
| 107 | Ga0466711_500456 | 3300042615 | Bacteria | 4630 |
| 108 | Ga0466718_048704 | 3300042617 | Bacteria | 2057 |
| 109 | Ga0123357_10266245 | 3300009784 | Bacteria | 1800 |
| 110 | Ga0123355_10000170 | 3300009826 | Bacteria | 79328 |
| 111 | Ga0123355_10008579 | 3300009826 | Bacteria | 15433 |
| 112 | Ga0123355_10051222 | 3300009826 | Bacteria | 6701 |
| 113 | Ga0123355_10169231 | 3300009826 | Bacteria | 3270 |
| 114 | Ga0123355_10332998 | 3300009826 | Bacteria | 2031 |
| 115 | Ga0123355_10435860 | 3300009826 | Bacteria | 1663 |
| 116 | Ga0123356_10004045 | 3300010049 | Unclassified | 15219 |
| 117 | Ga0123353_10020484 | 3300010167 | Bacteria | 9881 |
| 118 | Ga0123353_10154429 | 3300010167 | Bacteria | 3661 |
| 119 | Ga0123353_10413377 | 3300010167 | Bacteria | 2002 |
| 120 | Ga0123353_10453553 | 3300010167 | Unclassified | 1887 |
| 121 | Ga0123353_10580129 | 3300010167 | Bacteria | 1609 |
| 122 | Ga0123353_10648266 | 3300010167 | Bacteria | 1496 |
| 123 | 2227570487 | 2225789004 | Bacteria | 2617 |
| 124 | JGI24695J34938_10043144 | 3300002450 | Bacteria | 2014 |
| 125 | Ga0466704_287749 | 3300042643 | Bacteria | 4440 |
| 126 | Ga0466704_302946 | 3300042643 | Bacteria | 109363 |
| 127 | Ga0466727_217916 | 3300042655 | Bacteria | 6132 |
| 128 | Ga0466701_066620 | 3300042598 | Bacteria | 1637 |
| 129 | Ga0466707_144463 | 3300042601 | Bacteria | 2224 |
| 130 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 131 | Ga0466719_080776 | 3300042606 | Bacteria | 12096 |
| 132 | Ga0466693_416966 | 3300042592 | Unclassified | 2374 |
| 133 | Ga0466694_029770 | 3300042594 | Bacteria | 1540 |
| 134 | Ga0466694_392640 | 3300042594 | Bacteria | 1926 |
| 135 | Ga0466718_045575 | 3300042617 | Bacteria | 1414 |
| 136 | Ga0123355_10000702 | 3300009826 | Bacteria | 45395 |
| 137 | Ga0123355_10006578 | 3300009826 | Bacteria | 17240 |
| 138 | Ga0123355_10108951 | 3300009826 | Bacteria | 4334 |
| 139 | Ga0123355_10409390 | 3300009826 | Unclassified | 1742 |
| 140 | Ga0123356_10685864 | 3300010049 | Bacteria | 1193 |
| 141 | Ga0123353_10003928 | 3300010167 | Bacteria | 18993 |
| 142 | Ga0123353_10071776 | 3300010167 | Unclassified | 5563 |
| 143 | Ga0123353_10311515 | 3300010167 | Bacteria | 2395 |
| 144 | Ga0123354_10080565 | 3300010882 | Bacteria | 4608 |
| 145 | Ga0123354_10118566 | 3300010882 | Bacteria | 3435 |
| 146 | Ga0466733_175074 | 3300042659 | Bacteria | 1446 |
| 147 | Ga0562377_0504 | 3300056842 | Bacteria | 62033 |
| 148 | 2227474615 | 2225789004 | Bacteria | 23168 |
| 149 | IMNBL1DRAFT_c0000424 | 3300000062 | Bacteria | 35477 |
| 150 | IMNBL1DRAFT_c0026087 | 3300000062 | Bacteria | 2227 |
| 151 | IMNBL1DRAFT_c0046634 | 3300000062 | Bacteria | 1406 |
| 152 | Ga0466704_553282 | 3300042643 | Bacteria | 2047 |
| 153 | Ga0466724_09068 | 3300042649 | Bacteria | 1108 |
| 154 | Ga0466707_228792 | 3300042601 | Bacteria | 3269 |
| 155 | Ga0466707_292159 | 3300042601 | Bacteria | 2253 |
| 156 | Ga0466716_106009 | 3300042605 | Unclassified | 4374 |
| 157 | Ga0466719_393896 | 3300042606 | Bacteria | 10363 |
| 158 | Ga0466698_057014 | 3300042610 | Bacteria | 5586 |
| 159 | Ga0415639_104376 | 3300038395 | Bacteria | 17324 |
| 160 | Ga0466690_264132 | 3300042590 | Bacteria | 17629 |
| 161 | Ga0466690_310964 | 3300042590 | Unclassified | 3958 |
| 162 | Ga0466694_293576 | 3300042594 | Bacteria | 1909 |
| 163 | Ga0466726_252410 | 3300042619 | Bacteria | 3995 |
| 164 | Ga0466726_405130 | 3300042619 | Bacteria | 6241 |
| 165 | Ga0123355_10001714 | 3300009826 | Bacteria | 30528 |
| 166 | Ga0123355_10042242 | 3300009826 | Bacteria | 7421 |
| 167 | Ga0123355_10251979 | 3300009826 | Unclassified | 2484 |
| 168 | Ga0123356_10000750 | 3300010049 | Bacteria | 35917 |
| 169 | Ga0123356_10008796 | 3300010049 | Bacteria | 10002 |
| 170 | Ga0123353_10031224 | 3300010167 | Bacteria | 8247 |
| 171 | Ga0123353_10058679 | 3300010167 | Bacteria | 6167 |
| 172 | Ga0123353_10076067 | 3300010167 | Bacteria | 5394 |
| 173 | Ga0123353_10076359 | 3300010167 | Bacteria | 5383 |
| 174 | Ga0123353_10432879 | 3300010167 | Bacteria | 1944 |
| 175 | Ga0123353_10802527 | 3300010167 | Bacteria | 1299 |
| 176 | Ga0123353_10890767 | 3300010167 | Bacteria | 1213 |
| 177 | Ga0123354_10302344 | 3300010882 | Bacteria | 1511 |
| 178 | Ga0466732_407360 | 3300042656 | Bacteria | 5067 |
| 179 | 2227571843 | 2225789004 | Bacteria | 13926 |
| 180 | JGI24695J34938_10010960 | 3300002450 | Unclassified | 4922 |
| 181 | Ga0068302_10052705 | 3300005071 | Bacteria | 7254 |
| 182 | Ga0466727_347880 | 3300042655 | Unclassified | 8689 |
| 183 | Ga0466706_138852 | 3300042599 | Bacteria | 93255 |
| 184 | Ga0466706_287220 | 3300042599 | Bacteria | 76918 |
| 185 | Ga0466714_011576 | 3300042603 | Unclassified | 3821 |
| 186 | Ga0466719_146499 | 3300042606 | Bacteria | 3391 |
| 187 | Ga0466722_006350 | 3300042609 | Bacteria | 11807 |
| 188 | Ga0466722_103363 | 3300042609 | Bacteria | 6654 |
| 189 | Ga0466690_044435 | 3300042590 | Bacteria | 62131 |
| 190 | Ga0466695_115929 | 3300042595 | Bacteria | 2062 |
| 191 | Ga0466728_112803 | 3300042620 | Bacteria | 9632 |
| 192 | Ga0123355_10000314 | 3300009826 | Bacteria | 62371 |
| 193 | Ga0123355_10102664 | 3300009826 | Unclassified | 4497 |
| 194 | Ga0123355_10432573 | 3300009826 | Bacteria | 1672 |
| 195 | Ga0123356_10164835 | 3300010049 | Bacteria | 2219 |
| 196 | Ga0123353_10000417 | 3300010167 | Bacteria | 52511 |
| 197 | Ga0123353_10022539 | 3300010167 | Bacteria | 9501 |
| 198 | Ga0123353_10334215 | 3300010167 | Bacteria | 2291 |
| 199 | Ga0123353_10671124 | 3300010167 | Bacteria | 1462 |
| 200 | Ga0466705_117088 | 3300042612 | Bacteria | 4367 |
| 201 | Ga0466733_150523 | 3300042659 | Bacteria | 11640 |
| 202 | JGI24695J34938_10000192 | 3300002450 | Bacteria | 57017 |
| 203 | JGI24695J34938_10028512 | 3300002450 | Bacteria | 2623 |
| 204 | Ga0466703_076980 | 3300042636 | Bacteria | 17686 |
| 205 | Ga0466725_247646 | 3300042654 | Bacteria | 2052 |
| 206 | Ga0466700_167849 | 3300042600 | Bacteria | 33876 |
| 207 | Ga0466707_154428 | 3300042601 | Bacteria | 101562 |
| 208 | Ga0466716_415954 | 3300042605 | Bacteria | 12065 |
| 209 | Ga0415639_013923 | 3300038395 | Bacteria | 8252 |
| 210 | Ga0415639_094913 | 3300038395 | Bacteria | 1450 |
| 211 | Ga0415639_112849 | 3300038395 | Bacteria | 1218 |
| 212 | Ga0466690_222588 | 3300042590 | Bacteria | 1719 |
| 213 | Ga0466723_088170 | 3300042618 | Bacteria | 5312 |
| 214 | Ga0466723_278080 | 3300042618 | Unclassified | 3910 |
| 215 | Ga0466728_095171 | 3300042620 | Bacteria | 11826 |
| 216 | Ga0123357_10008023 | 3300009784 | Bacteria | 13138 |
| 217 | Ga0123357_10102672 | 3300009784 | Unclassified | 3680 |
| 218 | Ga0123355_10174766 | 3300009826 | Bacteria | 3201 |
| 219 | Ga0123355_10284887 | 3300009826 | Bacteria | 2275 |
| 220 | Ga0123353_10199321 | 3300010167 | Bacteria | 3151 |
| 221 | Ga0123353_10251762 | 3300010167 | Bacteria | 2735 |
| 222 | Ga0123353_10775486 | 3300010167 | Bacteria | 1329 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01116 | F_bP_aldolase | Fructose-bisphosphate aldolase class-II | 69 | 374 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.