Protein Family IF02302

Metagenome Metatranscriptome Isolate
122 Members
55 Samples
96 Scaffolds
174.15 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10001203|Ga0123355_1000120325
Length
156 aa
Sequence
MLRNLATNLLYHGRIQTTETRAKEVRKVAEKLITLAVKEKDNFSEVTKTFKVAQKDAAGRRVKKTVYDTVERKVKVDHPTRLNARRKILSVLYPVTEVPADGRKKRSLTTSVNMAEKLFNEIAPKYESRKGGYTRIIKIGKRKGDAAEMVFIELV*

📊 Sample Types

Isolate 21.3%
Metagenome 77.9%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 49.1%
Termitidae 34.0%
Termopsidae 5.7%
Kalotermitidae 5.7%
Hodotermitidae 1.9%
Rhinotermitidae 1.9%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
2 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
3 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
4 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
10 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
24 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
25 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
26 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
27 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
30 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
31 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
32 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
33 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
34 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
37 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
38 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
39 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
43 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
44 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
45 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
50 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
51 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
52 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
53 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
55 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0223677_1004576 3300021239 Bacteria 2255
2 Ga0415639_201391 3300038395 Bacteria 1557
3 Ga0123355_10001471 3300009826 Bacteria 32759
4 Ga0123355_10388150 3300009826 Bacteria 1812
5 Ga0123353_10042873 3300010167 Bacteria 7161
6 Ga0123353_10062630 3300010167 Bacteria 5965
7 Ga0466722_107279 3300042609 Bacteria 1386
8 JGI24703J35330_11723783 3300002501 Bacteria 2469
9 Ga0466705_061344 3300042612 Bacteria 17468
10 Ga0466733_125740 3300042659 Bacteria 1128
11 Ga0415639_026367 3300038395 Bacteria 19858
12 Ga0415639_036653 3300038395 Bacteria 2599
13 Ga0415639_041246 3300038395 Bacteria 4725
14 Ga0415639_079592 3300038395 Bacteria 3213
15 Ga0415639_099932 3300038395 Bacteria 3237
16 Ga0123355_10001203 3300009826 Bacteria 36038
17 Ga0466706_103864 3300042599 Bacteria 13046
18 Ga0466714_011158 3300042603 Unclassified 5407
19 Ga0466714_011230 3300042603 Bacteria 1209
20 Ga0466714_077025 3300042603 Unclassified 1757
21 Ga0466714_150226 3300042603 Bacteria 7330
22 Ga0466719_203918 3300042606 Bacteria 15671
23 IMNBL1DRAFT_c0000426 3300000062 Bacteria 35421
24 JGI24697J35500_11274940 3300002507 Bacteria 15937
25 Ga0072941_1007162 3300005201 Bacteria 33370
26 Ga0415639_009883 3300038395 Bacteria 16360
27 Ga0415639_142896 3300038395 Bacteria 1283
28 Ga0466712_283525 3300042614 Bacteria 2273
29 Ga0466726_324507 3300042619 Bacteria 16558
30 Ga0123355_10012755 3300009826 Bacteria 13033
31 Ga0123355_10036685 3300009826 Bacteria 7970
32 Ga0123355_10056741 3300009826 Bacteria 6338
33 Ga0123355_10392413 3300009826 Bacteria 1798
34 Ga0123356_12538940 3300010049 Bacteria 641
35 Ga0123353_10253977 3300010167 Bacteria 2720
36 Ga0123353_11313749 3300010167 Bacteria 938
37 Ga0466700_413888 3300042600 Bacteria 1236
38 JGI24695J34938_10000403 3300002450 Bacteria 42148
39 Ga0466693_291663 3300042592 Bacteria 2040
40 Ga0123355_10004431 3300009826 Bacteria 20424
41 Ga0123355_10030826 3300009826 Bacteria 8697
42 Ga0123355_10037361 3300009826 Bacteria 7897
43 Ga0123355_10109227 3300009826 Bacteria 4327
44 Ga0123355_10729451 3300009826 Bacteria 1127
45 Ga0123356_10747090 3300010049 Unclassified 1148
46 Ga0123353_10088307 3300010167 Bacteria 4993
47 Ga0466722_090267 3300042609 Bacteria 1965
48 Ga0072941_1233089 3300005201 Bacteria 4881
49 Ga0415639_015454 3300038395 Bacteria 11733
50 Ga0466710_187996 3300042613 Bacteria 1890
51 Ga0123355_10032582 3300009826 Bacteria 8459
52 Ga0123353_10223446 3300010167 Unclassified 2942
53 Ga0123353_10343061 3300010167 Bacteria 2255
54 Ga0123353_12067799 3300010167 Bacteria 695
55 Ga0466693_123263 3300042592 Bacteria 2716
56 Ga0466699_385939 3300042597 Bacteria 1795
57 Ga0123355_10787082 3300009826 Bacteria 1064
58 Ga0123356_10041278 3300010049 Bacteria 4299
59 Ga0466700_432738 3300042600 Bacteria 6555
60 Ga0466725_069889 3300042654 Bacteria 3786
61 Ga0466725_224368 3300042654 Bacteria 9572
62 Ga0466727_099274 3300042655 Bacteria 1328
63 IMNBL1DRAFT_c0010636 3300000062 Bacteria 4375
64 JGI24703J35330_11743454 3300002501 Bacteria 3910
65 JGI24700J35501_10930794 3300002508 Bacteria 24253
66 Ga0415639_014911 3300038395 Bacteria 11711
67 Ga0466693_133506 3300042592 Bacteria 1160
68 Ga0466693_149370 3300042592 Bacteria 5868
69 Ga0123357_10531989 3300009784 Bacteria 952
70 Ga0123355_10010920 3300009826 Bacteria 13973
71 Ga0123355_10035834 3300009826 Bacteria 8066
72 Ga0123355_10110504 3300009826 Bacteria 4296
73 Ga0123355_10171170 3300009826 Bacteria 3246
74 Ga0123355_10185230 3300009826 Bacteria 3080
75 Ga0123355_10252510 3300009826 Bacteria 2480
76 Ga0123355_10306068 3300009826 Bacteria 2160
77 Ga0123356_11027287 3300010049 Bacteria 994
78 Ga0466714_162255 3300042603 Bacteria 1390
79 Ga0466725_082702 3300042654 Bacteria 32093
80 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
81 JGI24702J35022_10013714 3300002462 Bacteria 4482
82 Ga0072941_1715128 3300005201 Bacteria 833
83 Ga0415639_008085 3300038395 Bacteria 2886
84 Ga0466693_295147 3300042592 Bacteria 1428
85 Ga0466715_232257 3300042616 Bacteria 9357
86 Ga0123357_10251249 3300009784 Bacteria 1891
87 Ga0123355_10003449 3300009826 Bacteria 22687
88 Ga0123355_10149733 3300009826 Bacteria 3548
89 Ga0123355_10150515 3300009826 Bacteria 3536
90 Ga0123355_10151816 3300009826 Bacteria 3517
91 Ga0123355_10222639 3300009826 Bacteria 2710
92 Ga0123355_10224732 3300009826 Unclassified 2693
93 Ga0123355_10389524 3300009826 Bacteria 1808
94 Ga0123355_10894949 3300009826 Bacteria 966
95 Ga0466735_050127 3300042624 Bacteria 1690
96 Ga0466725_226992 3300042654 Bacteria 1623

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01196 Ribosomal_L17 Ribosomal protein L17 1 155 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.