Protein Family IF02266
Metagenome
Isolate
176
Members
52
Samples
171
Scaffolds
69.14
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10865717|Ga0123357_108657172
- Length
- 80 aa
- Sequence
- MKIDKVREMSEAELNNELDKMKNELFNLRFQHVTGQLENPIKMRDVKRDIARVKTVIREKQIETDLKNKSEESQLEAQS*
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.3%
Kalotermitidae
25.0%
Unclassified
13.5%
Termopsidae
7.7%
Rhinotermitidae
5.8%
Passalidae
1.9%
Blattidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
166
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 33 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 34 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_342461 | 3300042612 | Bacteria | 4908 |
| 2 | Ga0123357_10865717 | 3300009784 | Bacteria | 593 |
| 3 | Ga0123356_10062470 | 3300010049 | Bacteria | 3479 |
| 4 | Ga0123353_10011361 | 3300010167 | Bacteria | 12538 |
| 5 | Ga0123353_12866406 | 3300010167 | Bacteria | 563 |
| 6 | Ga0123354_10059695 | 3300010882 | Bacteria | 5653 |
| 7 | Ga0123354_10285682 | 3300010882 | Unclassified | 1592 |
| 8 | Ga0466696_252118 | 3300042596 | Bacteria | 6477 |
| 9 | Ga0466706_185807 | 3300042599 | Bacteria | 5521 |
| 10 | Ga0466707_026798 | 3300042601 | Bacteria | 1134 |
| 11 | Ga0466707_102772 | 3300042601 | Bacteria | 10357 |
| 12 | Ga0466719_528471 | 3300042606 | Bacteria | 3008 |
| 13 | Ga0466722_250136 | 3300042609 | Bacteria | 3071 |
| 14 | JGI24705J35276_12064888 | 3300002504 | Bacteria | 942 |
| 15 | Ga0466703_424197 | 3300042636 | Bacteria | 2574 |
| 16 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 17 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 18 | Ga0466705_357809 | 3300042612 | Bacteria | 37083 |
| 19 | Ga0466733_212456 | 3300042659 | Bacteria | 1887 |
| 20 | Ga0466715_298115 | 3300042616 | Bacteria | 5916 |
| 21 | Ga0466715_299474 | 3300042616 | Bacteria | 2433 |
| 22 | Ga0123357_10431312 | 3300009784 | Bacteria | 1164 |
| 23 | Ga0123356_10052454 | 3300010049 | Bacteria | 3794 |
| 24 | Ga0123353_10000274 | 3300010167 | Bacteria | 64224 |
| 25 | Ga0123353_10019550 | 3300010167 | Bacteria | 10072 |
| 26 | Ga0123353_13264228 | 3300010167 | Bacteria | 518 |
| 27 | Ga0466657_120426 | 3300042582 | Bacteria | 1372 |
| 28 | Ga0466707_278333 | 3300042601 | Bacteria | 2633 |
| 29 | Ga0466713_149226 | 3300042602 | Bacteria | 1072 |
| 30 | Ga0466714_039083 | 3300042603 | Bacteria | 1647 |
| 31 | Ga0466719_039018 | 3300042606 | Bacteria | 2206 |
| 32 | Ga0466698_496867 | 3300042610 | Bacteria | 1712 |
| 33 | 2227490216 | 2225789004 | Bacteria | 795 |
| 34 | Ga0466735_077928 | 3300042624 | Bacteria | 1504 |
| 35 | Ga0466710_141598 | 3300042613 | Bacteria | 1035 |
| 36 | Ga0123356_10031620 | 3300010049 | Bacteria | 4952 |
| 37 | Ga0123356_13688578 | 3300010049 | Bacteria | 530 |
| 38 | Ga0123353_10209745 | 3300010167 | Bacteria | 3056 |
| 39 | Ga0123353_10686489 | 3300010167 | Bacteria | 1441 |
| 40 | Ga0123353_12694546 | 3300010167 | Bacteria | 585 |
| 41 | Ga0123354_10184268 | 3300010882 | Bacteria | 2368 |
| 42 | Ga0123354_10254821 | 3300010882 | Bacteria | 1768 |
| 43 | Ga0466656_368174 | 3300042550 | Bacteria | 1457 |
| 44 | Ga0466696_066447 | 3300042596 | Bacteria | 5902 |
| 45 | Ga0466696_359722 | 3300042596 | Bacteria | 2646 |
| 46 | Ga0466696_390265 | 3300042596 | Bacteria | 1039 |
| 47 | Ga0466713_128565 | 3300042602 | Bacteria | 50941 |
| 48 | JGI24702J35022_10027741 | 3300002462 | Bacteria | 3045 |
| 49 | Ga0068302_10005548 | 3300005071 | Bacteria | 4551 |
| 50 | Ga0466729_223134 | 3300042621 | Bacteria | 15957 |
| 51 | Ga0466729_243888 | 3300042621 | Bacteria | 4126 |
| 52 | Ga0466734_043868 | 3300042623 | Bacteria | 2972 |
| 53 | Ga0466735_039630 | 3300042624 | Unclassified | 2270 |
| 54 | Ga0466704_388849 | 3300042643 | Unclassified | 3618 |
| 55 | Ga0466709_014700 | 3300042648 | Bacteria | 1762 |
| 56 | Ga0466708_049775 | 3300042652 | Unclassified | 1135 |
| 57 | Ga0466708_352569 | 3300042652 | Bacteria | 2310 |
| 58 | Ga0466697_057752 | 3300042611 | Bacteria | 1745 |
| 59 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 60 | Ga0466715_118668 | 3300042616 | Bacteria | 9572 |
| 61 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 62 | Ga0466715_461135 | 3300042616 | Bacteria | 1102 |
| 63 | Ga0466728_286502 | 3300042620 | Bacteria | 4876 |
| 64 | Ga0123357_10445814 | 3300009784 | Bacteria | 1128 |
| 65 | Ga0123356_10125678 | 3300010049 | Bacteria | 2503 |
| 66 | Ga0123356_10537041 | 3300010049 | Bacteria | 1329 |
| 67 | Ga0123356_10905714 | 3300010049 | Bacteria | 1053 |
| 68 | Ga0123353_10393816 | 3300010167 | Bacteria | 2065 |
| 69 | Ga0466707_237293 | 3300042601 | Bacteria | 1845 |
| 70 | Ga0466707_243752 | 3300042601 | Bacteria | 10455 |
| 71 | Ga0466713_008709 | 3300042602 | Bacteria | 25958 |
| 72 | Ga0466719_130446 | 3300042606 | Bacteria | 3854 |
| 73 | Ga0466719_347643 | 3300042606 | Bacteria | 8218 |
| 74 | Ga0466719_414102 | 3300042606 | Unclassified | 1141 |
| 75 | JGI24705J35276_12238163 | 3300002504 | Bacteria | 16705 |
| 76 | Ga0466703_395127 | 3300042636 | Bacteria | 1561 |
| 77 | Ga0466704_255413 | 3300042643 | Bacteria | 1264 |
| 78 | Ga0466708_215601 | 3300042652 | Bacteria | 8054 |
| 79 | Ga0466733_091923 | 3300042659 | Bacteria | 5139 |
| 80 | Ga0466723_024418 | 3300042618 | Bacteria | 7163 |
| 81 | Ga0466726_091622 | 3300042619 | Bacteria | 2422 |
| 82 | Ga0123357_10450353 | 3300009784 | Bacteria | 1117 |
| 83 | Ga0123356_12917861 | 3300010049 | Bacteria | 598 |
| 84 | Ga0123353_10456446 | 3300010167 | Bacteria | 1879 |
| 85 | Ga0123353_10577277 | 3300010167 | Bacteria | 1614 |
| 86 | Ga0123354_10190419 | 3300010882 | Bacteria | 2300 |
| 87 | Ga0123354_10885155 | 3300010882 | Bacteria | 588 |
| 88 | Ga0466657_096055 | 3300042582 | Bacteria | 1165 |
| 89 | Ga0466691_188013 | 3300042593 | Bacteria | 6161 |
| 90 | Ga0466694_318348 | 3300042594 | Bacteria | 1015 |
| 91 | Ga0466696_181222 | 3300042596 | Bacteria | 9794 |
| 92 | Ga0466706_102231 | 3300042599 | Bacteria | 1284 |
| 93 | Ga0466706_137786 | 3300042599 | Bacteria | 1193 |
| 94 | Ga0466707_048054 | 3300042601 | Bacteria | 11948 |
| 95 | Ga0466713_020962 | 3300042602 | Bacteria | 8387 |
| 96 | Ga0466717_072789 | 3300042604 | Bacteria | 1042 |
| 97 | Ga0466722_252742 | 3300042609 | Bacteria | 2657 |
| 98 | JGI24705J35276_12164906 | 3300002504 | Bacteria | 1255 |
| 99 | Ga0068305_10059637 | 3300005083 | Bacteria | 5268 |
| 100 | Ga0466735_116242 | 3300042624 | Bacteria | 1059 |
| 101 | Ga0466703_132134 | 3300042636 | Bacteria | 9668 |
| 102 | Ga0466704_101451 | 3300042643 | Bacteria | 28867 |
| 103 | Ga0466704_353103 | 3300042643 | Bacteria | 17158 |
| 104 | Ga0466727_136476 | 3300042655 | Bacteria | 1030 |
| 105 | Ga0466711_368768 | 3300042615 | Bacteria | 1772 |
| 106 | Ga0466715_599174 | 3300042616 | Bacteria | 1639 |
| 107 | Ga0466718_058582 | 3300042617 | Bacteria | 1488 |
| 108 | Ga0123356_13681180 | 3300010049 | Unclassified | 530 |
| 109 | Ga0123353_11893629 | 3300010167 | Unclassified | 736 |
| 110 | Ga0466696_232378 | 3300042596 | Bacteria | 6933 |
| 111 | Ga0466707_098926 | 3300042601 | Bacteria | 16720 |
| 112 | Ga0466707_132787 | 3300042601 | Bacteria | 13579 |
| 113 | Ga0466713_019517 | 3300042602 | Bacteria | 68401 |
| 114 | Ga0466716_157301 | 3300042605 | Bacteria | 6875 |
| 115 | Ga0466722_238982 | 3300042609 | Bacteria | 5314 |
| 116 | Ga0068305_10726695 | 3300005083 | Bacteria | 823 |
| 117 | Ga0466704_617916 | 3300042643 | Bacteria | 3009 |
| 118 | Ga0466697_090522 | 3300042611 | Bacteria | 1830 |
| 119 | Ga0466723_317218 | 3300042618 | Bacteria | 2907 |
| 120 | Ga0466726_380315 | 3300042619 | Bacteria | 17436 |
| 121 | Ga0123357_10008010 | 3300009784 | Bacteria | 13145 |
| 122 | Ga0123356_10122111 | 3300010049 | Bacteria | 2536 |
| 123 | Ga0123356_10639719 | 3300010049 | Bacteria | 1230 |
| 124 | Ga0123356_10706279 | 3300010049 | Unclassified | 1177 |
| 125 | Ga0123353_10064388 | 3300010167 | Bacteria | 5883 |
| 126 | Ga0123353_10124877 | 3300010167 | Bacteria | 4136 |
| 127 | Ga0123353_10631978 | 3300010167 | Bacteria | 1521 |
| 128 | Ga0123353_11530684 | 3300010167 | Bacteria | 847 |
| 129 | Ga0123353_11835365 | 3300010167 | Unclassified | 751 |
| 130 | Ga0123354_10161207 | 3300010882 | Bacteria | 2662 |
| 131 | Ga0466692_151313 | 3300042591 | Bacteria | 9518 |
| 132 | Ga0466700_127609 | 3300042600 | Bacteria | 1820 |
| 133 | Ga0466707_409934 | 3300042601 | Bacteria | 1336 |
| 134 | Ga0466719_000563 | 3300042606 | Bacteria | 1453 |
| 135 | Ga0466719_036101 | 3300042606 | Bacteria | 1016 |
| 136 | 2227414160 | 2225789004 | Bacteria | 5671 |
| 137 | Ga0466734_032846 | 3300042623 | Bacteria | 1163 |
| 138 | Ga0466703_375570 | 3300042636 | Bacteria | 1490 |
| 139 | Ga0466725_109431 | 3300042654 | Bacteria | 1952 |
| 140 | Ga0466727_274018 | 3300042655 | Bacteria | 1064 |
| 141 | Ga0466733_164265 | 3300042659 | Bacteria | 2529 |
| 142 | Ga0466723_043785 | 3300042618 | Bacteria | 2625 |
| 143 | Ga0466726_060368 | 3300042619 | Bacteria | 11472 |
| 144 | Ga0466726_364461 | 3300042619 | Bacteria | 33247 |
| 145 | Ga0466726_387933 | 3300042619 | Bacteria | 1447 |
| 146 | Ga0466728_082463 | 3300042620 | Bacteria | 32980 |
| 147 | Ga0123357_10098417 | 3300009784 | Bacteria | 3781 |
| 148 | Ga0123355_11218211 | 3300009826 | Unclassified | 766 |
| 149 | Ga0123353_10214582 | 3300010167 | Bacteria | 3015 |
| 150 | Ga0123353_10284976 | 3300010167 | Bacteria | 2534 |
| 151 | Ga0123353_10321937 | 3300010167 | Bacteria | 2346 |
| 152 | Ga0123353_10368111 | 3300010167 | Bacteria | 2156 |
| 153 | Ga0123353_10410512 | 3300010167 | Bacteria | 2011 |
| 154 | Ga0123353_10456041 | 3300010167 | Bacteria | 1880 |
| 155 | Ga0123353_10679719 | 3300010167 | Bacteria | 1450 |
| 156 | Ga0123353_11305964 | 3300010167 | Bacteria | 941 |
| 157 | Ga0123353_11776630 | 3300010167 | Bacteria | 768 |
| 158 | Ga0123353_12118352 | 3300010167 | Bacteria | 684 |
| 159 | Ga0123353_13118327 | 3300010167 | Bacteria | 533 |
| 160 | Ga0123354_10033652 | 3300010882 | Bacteria | 8022 |
| 161 | Ga0123354_10384801 | 3300010882 | Bacteria | 1206 |
| 162 | Ga0466706_051212 | 3300042599 | Bacteria | 1278 |
| 163 | Ga0466700_071403 | 3300042600 | Bacteria | 3021 |
| 164 | Ga0466707_077367 | 3300042601 | Bacteria | 1744 |
| 165 | Ga0466722_173467 | 3300042609 | Bacteria | 3100 |
| 166 | JGI24702J35022_10017033 | 3300002462 | Bacteria | 3977 |
| 167 | Ga0068302_10688007 | 3300005071 | Bacteria | 500 |
| 168 | Ga0466731_423403 | 3300042622 | Bacteria | 1745 |
| 169 | Ga0466734_122793 | 3300042623 | Bacteria | 1337 |
| 170 | Ga0466702_050921 | 3300042635 | Bacteria | 1098 |
| 171 | Ga0466704_031146 | 3300042643 | Bacteria | 38318 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00831 | Ribosomal_L29 | Ribosomal L29 protein | 5 | 60 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.