Protein Family IF02254
Metagenome
Isolate
116
Members
43
Samples
109
Scaffolds
320.71
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10372790|Ga0123357_103727901
- Length
- 371 aa
- Sequence
- MKLIIQIPCYNEEKTLPQTIADLPRHIDGIDEIEYLIVNDGSTDGTVEVARAVGVHHIVNFKRNKGLSHVFTAGLDACLRLGADIIVNTDADNQYDGHDIEKLIAPILYGTVDIVVGARSIDNIEHFSAKKKRLQHVGSWIVRVASGTDIPDAPSGFRAFSRDAAMRINVINAYTYTLETIIQAGVHRMAITSVPIHTNPETRKSRLFKSIPAYLKRSSSVIIRSFMMYRPLKFFSGLGAISFVIGLIFAIRFVVLAATGYGSGHIQSLVLAAVLLLVGIQLIVAGMQADLTAASRKILEDIQYRVRKIEMNEFADVSDIIENPVLNEANEIGVYSGTSGDSAIVSAAAGHQARSGEAERVGAGGKRGGR*
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.1%
Kalotermitidae
26.2%
Unclassified
16.7%
Rhinotermitidae
7.1%
Vespidae
2.4%
Hodotermitidae
2.4%
Culicidae
2.4%
Passalidae
2.4%
Termopsidae
2.4%
Taxonomy
Archaea
1
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 7 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 8 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 16 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 38 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10372790 | 3300009784 | Bacteria | 1336 |
| 2 | Ga0123356_10004967 | 3300010049 | Bacteria | 13636 |
| 3 | Ga0123356_10289987 | 3300010049 | Bacteria | 1736 |
| 4 | Ga0123353_10009543 | 3300010167 | Bacteria | 13414 |
| 5 | Ga0123353_10208483 | 3300010167 | Bacteria | 3067 |
| 6 | Ga0123353_10263829 | 3300010167 | Bacteria | 2658 |
| 7 | Ga0466713_117646 | 3300042602 | Bacteria | 9079 |
| 8 | Ga0466715_344085 | 3300042616 | Bacteria | 5257 |
| 9 | Ga0466728_119193 | 3300042620 | Bacteria | 1190 |
| 10 | Ga0415639_002606 | 3300038395 | Bacteria | 86598 |
| 11 | Ga0415639_025943 | 3300038395 | Bacteria | 2522 |
| 12 | Ga0415639_029890 | 3300038395 | Bacteria | 33874 |
| 13 | Ga0415639_057378 | 3300038395 | Bacteria | 1500 |
| 14 | Ga0466705_016855 | 3300042612 | Bacteria | 2817 |
| 15 | Ga0466705_031293 | 3300042612 | Bacteria | 1886 |
| 16 | Ga0123355_10111529 | 3300009826 | Unclassified | 4272 |
| 17 | Ga0123356_10053569 | 3300010049 | Bacteria | 3755 |
| 18 | Ga0123356_10063240 | 3300010049 | Bacteria | 3458 |
| 19 | Ga0123353_10295385 | 3300010167 | Bacteria | 2477 |
| 20 | Ga0123353_10300522 | 3300010167 | Bacteria | 2450 |
| 21 | Ga0123353_10371444 | 3300010167 | Bacteria | 2144 |
| 22 | Ga0123353_10480634 | 3300010167 | Bacteria | 1818 |
| 23 | Ga0123353_10490693 | 3300010167 | Bacteria | 1793 |
| 24 | Ga0123353_10717257 | 3300010167 | Bacteria | 1400 |
| 25 | Ga0466704_355486 | 3300042643 | Unclassified | 6017 |
| 26 | Ga0466707_189590 | 3300042601 | Bacteria | 14096 |
| 27 | Ga0466717_274890 | 3300042604 | Bacteria | 1215 |
| 28 | Ga0466719_046085 | 3300042606 | Bacteria | 10202 |
| 29 | Ga0466728_104057 | 3300042620 | Bacteria | 17641 |
| 30 | Ga0415639_049864 | 3300038395 | Unclassified | 15111 |
| 31 | Ga0466692_069409 | 3300042591 | Bacteria | 11085 |
| 32 | Ga0466692_152269 | 3300042591 | Bacteria | 1856 |
| 33 | Ga0123355_10001708 | 3300009826 | Bacteria | 30564 |
| 34 | Ga0123355_10165366 | 3300009826 | Bacteria | 3322 |
| 35 | Ga0123356_10000180 | 3300010049 | Bacteria | 72138 |
| 36 | Ga0123356_10005593 | 3300010049 | Bacteria | 12784 |
| 37 | Ga0123356_10107491 | 3300010049 | Bacteria | 2688 |
| 38 | Ga0123356_10208683 | 3300010049 | Bacteria | 2000 |
| 39 | Ga0123356_10347689 | 3300010049 | Bacteria | 1605 |
| 40 | Ga0123353_10071819 | 3300010167 | Archaea | 5562 |
| 41 | Ga0123353_10114433 | 3300010167 | Bacteria | 4343 |
| 42 | Ga0466729_271149 | 3300042621 | Bacteria | 100204 |
| 43 | Ga0466708_113300 | 3300042652 | Bacteria | 53667 |
| 44 | IMNBL1DRAFT_c0000573 | 3300000062 | Bacteria | 29647 |
| 45 | Ga0072941_1532201 | 3300005201 | Bacteria | 2124 |
| 46 | Ga0466707_029992 | 3300042601 | Bacteria | 3476 |
| 47 | Ga0466705_403468 | 3300042612 | Bacteria | 4674 |
| 48 | Ga0466723_155309 | 3300042618 | Bacteria | 6480 |
| 49 | Ga0123355_10002254 | 3300009826 | Bacteria | 27209 |
| 50 | Ga0123356_10016817 | 3300010049 | Bacteria | 6969 |
| 51 | Ga0123356_10061671 | 3300010049 | Bacteria | 3502 |
| 52 | Ga0123353_10156817 | 3300010167 | Bacteria | 3628 |
| 53 | Ga0466708_116611 | 3300042652 | Bacteria | 38548 |
| 54 | Ga0466727_268303 | 3300042655 | Bacteria | 1540 |
| 55 | JGI24703J35330_11748710 | 3300002501 | Bacteria | 27547 |
| 56 | Ga0466721_382749 | 3300042608 | Bacteria | 61582 |
| 57 | Ga0466715_440306 | 3300042616 | Bacteria | 3436 |
| 58 | Ga0466733_188610 | 3300042659 | Bacteria | 9726 |
| 59 | Ga0123357_10051009 | 3300009784 | Bacteria | 5597 |
| 60 | Ga0123355_10003225 | 3300009826 | Bacteria | 23305 |
| 61 | Ga0123353_10009684 | 3300010167 | Bacteria | 13343 |
| 62 | Ga0123353_10012423 | 3300010167 | Bacteria | 12105 |
| 63 | Ga0123354_10052140 | 3300010882 | Bacteria | 6166 |
| 64 | Ga0466704_598480 | 3300042643 | Bacteria | 35700 |
| 65 | Ga0466725_451331 | 3300042654 | Bacteria | 3333 |
| 66 | JGI24702J35022_10002663 | 3300002462 | Bacteria | 10838 |
| 67 | JGI24702J35022_10006847 | 3300002462 | Bacteria | 6562 |
| 68 | Ga0466706_275750 | 3300042599 | Bacteria | 2818 |
| 69 | Ga0466711_174311 | 3300042615 | Bacteria | 18554 |
| 70 | Ga0466715_412741 | 3300042616 | Bacteria | 1310 |
| 71 | Ga0466723_240599 | 3300042618 | Bacteria | 21672 |
| 72 | Ga0466690_067592 | 3300042590 | Bacteria | 2249 |
| 73 | Ga0466693_282351 | 3300042592 | Bacteria | 2369 |
| 74 | Ga0466691_206410 | 3300042593 | Bacteria | 4097 |
| 75 | Ga0123355_10000045 | 3300009826 | Bacteria | 123106 |
| 76 | Ga0123353_10000057 | 3300010167 | Bacteria | 126118 |
| 77 | Ga0123353_10375409 | 3300010167 | Bacteria | 2129 |
| 78 | Ga0123353_10394711 | 3300010167 | Bacteria | 2062 |
| 79 | Ga0466705_513253 | 3300042612 | Bacteria | 3361 |
| 80 | Ga0466711_414236 | 3300042615 | Bacteria | 3396 |
| 81 | Ga0160460_100457 | 3300012845 | Bacteria | 24883 |
| 82 | Ga0123357_10353929 | 3300009784 | Bacteria | 1401 |
| 83 | Ga0123355_10001508 | 3300009826 | Bacteria | 32461 |
| 84 | Ga0123355_10002428 | 3300009826 | Bacteria | 26328 |
| 85 | Ga0123355_10684420 | 3300009826 | Unclassified | 1184 |
| 86 | Ga0123353_10386475 | 3300010167 | Bacteria | 2091 |
| 87 | Ga0123353_10570680 | 3300010167 | Bacteria | 1626 |
| 88 | Ga0466708_413194 | 3300042652 | Bacteria | 28742 |
| 89 | Ga0466706_046119 | 3300042599 | Bacteria | 4857 |
| 90 | Ga0466707_154332 | 3300042601 | Bacteria | 10793 |
| 91 | Ga0466707_250526 | 3300042601 | Bacteria | 4325 |
| 92 | Ga0466716_202955 | 3300042605 | Bacteria | 1704 |
| 93 | Ga0466715_558494 | 3300042616 | Bacteria | 9872 |
| 94 | Ga0415639_004645 | 3300038395 | Bacteria | 20533 |
| 95 | Ga0466694_307328 | 3300042594 | Bacteria | 18402 |
| 96 | Ga0123355_10001060 | 3300009826 | Bacteria | 37980 |
| 97 | Ga0123355_10004373 | 3300009826 | Bacteria | 20550 |
| 98 | Ga0123355_10023569 | 3300009826 | Bacteria | 9885 |
| 99 | Ga0123356_10614955 | 3300010049 | Bacteria | 1252 |
| 100 | Ga0123353_10026178 | 3300010167 | Bacteria | 8903 |
| 101 | Ga0123353_10248284 | 3300010167 | Bacteria | 2759 |
| 102 | Ga0466700_195581 | 3300042600 | Bacteria | 4247 |
| 103 | Ga0466722_108254 | 3300042609 | Bacteria | 6613 |
| 104 | Ga0466711_502457 | 3300042615 | Bacteria | 11118 |
| 105 | Ga0466715_155690 | 3300042616 | Bacteria | 3991 |
| 106 | Ga0466728_055323 | 3300042620 | Bacteria | 1311 |
| 107 | Ga0415639_050387 | 3300038395 | Bacteria | 9597 |
| 108 | Ga0415639_201870 | 3300038395 | Bacteria | 3704 |
| 109 | Ga0466694_223625 | 3300042594 | Unclassified | 1131 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00535 | Glycos_transf_2 | Glycosyl transferase family 2 | 7 | 166 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.