Protein Family IF02245
Metagenome
Isolate
120
Members
56
Samples
110
Scaffolds
293.29
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10274749|Ga0123357_102747492
- Length
- 345 aa
- Sequence
- MSRTGYTAFKSGSPEELPYEKLNQTTRKISLKTSGYLGILKAEERRHQMSKTSIRFFDDKEVRAVWDDDSSKWWFSAVDIVGVLSQSTDSRNYWYVLKNRLKKAGSEVLTNCKGFKQMAPDGKHRTTDCLTNDGVIALAKEFPGKKANRFIEWFTYSEDTIDGKSKSKAYALFDSSLLDTIEVGTVKGLQQIHGYLFGGLYDFAGQIRTLNIAKGGFKFAVARFLPETLKTIEQMPDTDFEEIADKYIEMNVAHPFMEGNGRSTRIWLDLILKKRLRLCIDWSQIDKKGYLSAMEKSVANGAQIKSLLQNALTDKINDREVFMKGIDYSYYYEQENDITGDDEK*
Sample Types
Isolate
8.3%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Unclassified
21.8%
Kalotermitidae
21.8%
Termopsidae
5.5%
Passalidae
3.6%
Rhinotermitidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
3
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2773857679 | Unclassified Methanomassiliicoccaceae Cu122P4bin8 | Isolate | Unclassified |
| 6 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 7 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 8 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 9 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 10 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 21 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 24 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10001427 | 3300010167 | Bacteria | 29228 |
| 2 | Ga0466731_074379 | 3300042622 | Bacteria | 7103 |
| 3 | Ga0466704_173086 | 3300042643 | Bacteria | 14728 |
| 4 | Ga0466704_384324 | 3300042643 | Bacteria | 2147 |
| 5 | Ga0466708_178773 | 3300042652 | Bacteria | 8613 |
| 6 | JGI24695J34938_10027419 | 3300002450 | Bacteria | 2692 |
| 7 | JGI24695J34938_10034625 | 3300002450 | Bacteria | 2316 |
| 8 | Ga0123357_10000533 | 3300009784 | Bacteria | 37401 |
| 9 | Ga0466713_125045 | 3300042602 | Bacteria | 5041 |
| 10 | Ga0466717_312070 | 3300042604 | Bacteria | 2819 |
| 11 | Ga0466716_302468 | 3300042605 | Bacteria | 23384 |
| 12 | Ga0466694_000795 | 3300042594 | Bacteria | 3583 |
| 13 | Ga0466696_289123 | 3300042596 | Bacteria | 1562 |
| 14 | Ga0466715_270118 | 3300042616 | Bacteria | 3661 |
| 15 | Ga0123356_10005206 | 3300010049 | Bacteria | 13295 |
| 16 | Ga0123356_10098099 | 3300010049 | Bacteria | 2805 |
| 17 | Ga0123356_10980975 | 3300010049 | Bacteria | 1015 |
| 18 | Ga0123353_10416083 | 3300010167 | Bacteria | 1994 |
| 19 | Ga0466715_373478 | 3300042616 | Bacteria | 15598 |
| 20 | Ga0123356_10082728 | 3300010049 | Bacteria | 3040 |
| 21 | Ga0123356_10590659 | 3300010049 | Bacteria | 1274 |
| 22 | Ga0123353_10002848 | 3300010167 | Bacteria | 21620 |
| 23 | Ga0123353_10097702 | 3300010167 | Bacteria | 4733 |
| 24 | Ga0123353_10164059 | 3300010167 | Bacteria | 3534 |
| 25 | Ga0466705_183265 | 3300042612 | Bacteria | 3388 |
| 26 | Ga0466731_362726 | 3300042622 | Bacteria | 1979 |
| 27 | Ga0466734_036998 | 3300042623 | Bacteria | 1590 |
| 28 | Ga0466704_525205 | 3300042643 | Bacteria | 3464 |
| 29 | IMNBL1DRAFT_c0015014 | 3300000062 | Bacteria | 3381 |
| 30 | JGI24702J35022_10000894 | 3300002462 | Bacteria | 18528 |
| 31 | JGI24705J35276_12195051 | 3300002504 | Bacteria | 1520 |
| 32 | Ga0072940_1192275 | 3300005200 | Bacteria | 984 |
| 33 | Ga0466706_125047 | 3300042599 | Bacteria | 6354 |
| 34 | Ga0466700_005216 | 3300042600 | Bacteria | 1756 |
| 35 | Ga0466698_227777 | 3300042610 | Bacteria | 2382 |
| 36 | Ga0466690_180791 | 3300042590 | Bacteria | 1807 |
| 37 | Ga0466693_106328 | 3300042592 | Bacteria | 2349 |
| 38 | Ga0466691_102347 | 3300042593 | Bacteria | 1408 |
| 39 | Ga0466710_026130 | 3300042613 | Bacteria | 1005 |
| 40 | Ga0466726_219204 | 3300042619 | Bacteria | 9354 |
| 41 | Ga0123357_10043522 | 3300009784 | Bacteria | 6101 |
| 42 | Ga0123357_10113300 | 3300009784 | Bacteria | 3448 |
| 43 | Ga0123353_10000222 | 3300010167 | Bacteria | 72156 |
| 44 | Ga0123353_10009456 | 3300010167 | Bacteria | 13466 |
| 45 | Ga0466705_308341 | 3300042612 | Bacteria | 1996 |
| 46 | Ga0068302_10006116 | 3300005071 | Bacteria | 10405 |
| 47 | Ga0466700_419497 | 3300042600 | Bacteria | 5992 |
| 48 | Ga0466698_465129 | 3300042610 | Bacteria | 4142 |
| 49 | Ga0415639_006505 | 3300038395 | Bacteria | 2412 |
| 50 | Ga0466657_072008 | 3300042582 | Bacteria | 27064 |
| 51 | Ga0466692_154281 | 3300042591 | Bacteria | 3148 |
| 52 | Ga0466693_017167 | 3300042592 | Bacteria | 1073 |
| 53 | Ga0466693_227863 | 3300042592 | Bacteria | 3679 |
| 54 | Ga0466696_132750 | 3300042596 | Bacteria | 1291 |
| 55 | Ga0466699_370029 | 3300042597 | Bacteria | 1197 |
| 56 | Ga0123357_10274749 | 3300009784 | Bacteria | 1753 |
| 57 | Ga0123355_10747445 | 3300009826 | Bacteria | 1107 |
| 58 | Ga0123356_10156808 | 3300010049 | Bacteria | 2268 |
| 59 | Ga0123353_10314369 | 3300010167 | Bacteria | 2381 |
| 60 | Ga0123354_10367095 | 3300010882 | Unclassified | 1261 |
| 61 | Ga0466731_289333 | 3300042622 | Bacteria | 23043 |
| 62 | Ga0466708_036680 | 3300042652 | Bacteria | 14829 |
| 63 | 2227672939 | 2225789004 | Bacteria | 1889 |
| 64 | Ga0466701_028663 | 3300042598 | Archaea | 4444 |
| 65 | Ga0466707_137281 | 3300042601 | Bacteria | 1190 |
| 66 | Ga0466707_391832 | 3300042601 | Bacteria | 6856 |
| 67 | Ga0466713_027432 | 3300042602 | Bacteria | 5300 |
| 68 | Ga0466721_117647 | 3300042608 | Unclassified | 1015 |
| 69 | Ga0466696_478131 | 3300042596 | Bacteria | 4098 |
| 70 | Ga0466711_169981 | 3300042615 | Bacteria | 12126 |
| 71 | Ga0466711_437810 | 3300042615 | Bacteria | 2522 |
| 72 | Ga0466715_056401 | 3300042616 | Bacteria | 1793 |
| 73 | Ga0466726_428163 | 3300042619 | Bacteria | 2088 |
| 74 | Ga0466728_212425 | 3300042620 | Bacteria | 7485 |
| 75 | Ga0123353_10087084 | 3300010167 | Bacteria | 5031 |
| 76 | Ga0466705_147179 | 3300042612 | Bacteria | 9569 |
| 77 | Ga0466731_363326 | 3300042622 | Bacteria | 2250 |
| 78 | Ga0466704_487845 | 3300042643 | Bacteria | 1078 |
| 79 | Ga0466708_015349 | 3300042652 | Bacteria | 9632 |
| 80 | JGI24695J34938_10002816 | 3300002450 | Bacteria | 12700 |
| 81 | JGI24702J35022_10108942 | 3300002462 | Bacteria | 1522 |
| 82 | Ga0068302_10064761 | 3300005071 | Bacteria | 2515 |
| 83 | Ga0466717_246815 | 3300042604 | Bacteria | 1500 |
| 84 | Ga0466694_289466 | 3300042594 | Bacteria | 1346 |
| 85 | Ga0466699_063802 | 3300042597 | Bacteria | 1323 |
| 86 | Ga0466715_280399 | 3300042616 | Bacteria | 9359 |
| 87 | Ga0466715_582410 | 3300042616 | Bacteria | 1265 |
| 88 | Ga0466723_229501 | 3300042618 | Bacteria | 4074 |
| 89 | Ga0123353_10193286 | 3300010167 | Bacteria | 3210 |
| 90 | Ga0123353_10553028 | 3300010167 | Bacteria | 1659 |
| 91 | Ga0466705_107830 | 3300042612 | Bacteria | 6362 |
| 92 | Ga0466702_157643 | 3300042635 | Bacteria | 1512 |
| 93 | Ga0466727_242056 | 3300042655 | Bacteria | 12576 |
| 94 | JGI24695J34938_10001111 | 3300002450 | Bacteria | 24278 |
| 95 | Ga0466713_008999 | 3300042602 | Bacteria | 1207 |
| 96 | Ga0466713_134397 | 3300042602 | Bacteria | 97168 |
| 97 | Ga0466719_323705 | 3300042606 | Bacteria | 8339 |
| 98 | Ga0466720_180564 | 3300042607 | Bacteria | 3914 |
| 99 | Ga0264413_125474 | 3300024493 | Bacteria | 28962 |
| 100 | Ga0466690_415222 | 3300042590 | Bacteria | 2723 |
| 101 | Ga0466693_044186 | 3300042592 | Bacteria | 1376 |
| 102 | Ga0466715_596626 | 3300042616 | Bacteria | 4959 |
| 103 | Ga0123353_10951998 | 3300010167 | Unclassified | 1161 |
| 104 | Ga0123353_11122721 | 3300010167 | Bacteria | 1041 |
| 105 | Ga0466705_163757 | 3300042612 | Bacteria | 3172 |
| 106 | Ga0466705_268829 | 3300042612 | Bacteria | 2427 |
| 107 | Ga0466704_324690 | 3300042643 | Unclassified | 2280 |
| 108 | Ga0466708_015015 | 3300042652 | Bacteria | 16444 |
| 109 | IMNBL1DRAFT_c0048698 | 3300000062 | Bacteria | 1357 |
| 110 | Ga0466711_412373 | 3300042615 | Bacteria | 1147 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.