Protein Family IF02178
Metagenome
Isolate
325
Members
103
Samples
286
Scaffolds
242.23
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10008660|Ga0123357_100086606
- Length
- 293 aa
- Sequence
- MSGAENATKEEQLHNFYLALNEYGGFISIGLNVFFSRLKQNFLYICKLISLISCMKIALIGYGKMGHTIEEIAKERGHTIVSVIDIDNQGDFDSPQFLSADVAIEFSQPQSAFNNYRKCFERNIPVVAGTTGWLDHWDEIKNLCTKGNQTFFYASNYSVGMNVFFALNKCLAKIMNNFPAYDVRMEEVHHIHKLDSPSGTAISLAGNILENIDRKKRWKESSEGTNEDLLIQAKREGEVPGIHEVVYESDVDEIRIRHSAKNRRGLALGAVMAAEFVKGKKGFLSMNDMLDF*
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.7%
Blattidae
15.8%
Unclassified
14.9%
Kalotermitidae
13.9%
Formicidae
5.0%
Rhinotermitidae
5.0%
Termopsidae
4.0%
Cicadellidae
4.0%
Passalidae
3.0%
Hydrophilidae
2.0%
Drosophilidae
2.0%
Pseudophyllodromiidae
2.0%
Aphrophoridae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
312
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 4 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 8 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 9 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 20 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 21 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 22 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 26 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 33 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 34 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 41 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 42 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 52 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 55 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 56 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 64 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 65 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 66 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 69 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 70 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 71 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 72 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 73 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 74 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 75 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 76 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 77 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 78 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 79 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 80 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 81 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 82 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 83 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 84 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 85 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 86 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 87 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 88 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 89 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 90 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 91 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 92 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 93 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 94 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 95 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 96 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 97 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 98 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 99 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 100 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 101 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 102 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 103 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_146968 | 3300042659 | Bacteria | 1809 |
| 2 | Ga0466733_172872 | 3300042659 | Unclassified | 6351 |
| 3 | Ga0466692_024114 | 3300042591 | Bacteria | 7003 |
| 4 | Ga0466692_168149 | 3300042591 | Bacteria | 1578 |
| 5 | Ga0466691_094356 | 3300042593 | Bacteria | 1335 |
| 6 | Ga0466696_095719 | 3300042596 | Bacteria | 4174 |
| 7 | Ga0123353_10028089 | 3300010167 | Unclassified | 8635 |
| 8 | Ga0123354_10004445 | 3300010882 | Bacteria | 19882 |
| 9 | Ga0123354_10335113 | 3300010882 | Bacteria | 1373 |
| 10 | Ga0466711_146490 | 3300042615 | Unclassified | 3829 |
| 11 | Ga0466715_046045 | 3300042616 | Bacteria | 6673 |
| 12 | Ga0466726_062198 | 3300042619 | Bacteria | 13902 |
| 13 | Ga0466700_316391 | 3300042600 | Bacteria | 3224 |
| 14 | Ga0466707_281523 | 3300042601 | Bacteria | 23923 |
| 15 | Ga0466713_010652 | 3300042602 | Bacteria | 41319 |
| 16 | Ga0466713_011249 | 3300042602 | Bacteria | 73032 |
| 17 | Ga0466713_105312 | 3300042602 | Bacteria | 60870 |
| 18 | Ga0466713_140716 | 3300042602 | Bacteria | 27446 |
| 19 | Ga0466716_271947 | 3300042605 | Unclassified | 2868 |
| 20 | Ga0466719_236042 | 3300042606 | Bacteria | 7647 |
| 21 | 2227516019 | 2225789004 | Bacteria | 3445 |
| 22 | IMNBL1DRAFT_c0002474 | 3300000062 | Bacteria | 12842 |
| 23 | IMNBL1DRAFT_c0005255 | 3300000062 | Bacteria | 7469 |
| 24 | JGI24702J35022_10020516 | 3300002462 | Bacteria | 3586 |
| 25 | JGI24702J35022_10198521 | 3300002462 | Bacteria | 1147 |
| 26 | JGI24699J35502_11133367 | 3300002509 | Bacteria | 10127 |
| 27 | JGI24699J35502_11134129 | 3300002509 | Bacteria | 34657 |
| 28 | JGI24696J40584_12792516 | 3300002834 | Bacteria | 855 |
| 29 | Ga0072941_1038734 | 3300005201 | Bacteria | 2939 |
| 30 | Ga0102735_1000047 | 3300007080 | Bacteria | 32072 |
| 31 | Ga0123357_10000608 | 3300009784 | Bacteria | 35490 |
| 32 | Ga0466697_254037 | 3300042611 | Bacteria | 2204 |
| 33 | Ga0466735_056233 | 3300042624 | Bacteria | 1144 |
| 34 | Ga0466703_022324 | 3300042636 | Bacteria | 8358 |
| 35 | Ga0466703_276653 | 3300042636 | Bacteria | 5771 |
| 36 | Ga0466703_286565 | 3300042636 | Bacteria | 10843 |
| 37 | Ga0466703_318682 | 3300042636 | Bacteria | 11416 |
| 38 | Ga0466704_121841 | 3300042643 | Bacteria | 12540 |
| 39 | Ga0466704_168570 | 3300042643 | Bacteria | 7098 |
| 40 | Ga0466704_417401 | 3300042643 | Bacteria | 7074 |
| 41 | Ga0466704_503416 | 3300042643 | Bacteria | 12957 |
| 42 | Ga0466709_075468 | 3300042648 | Bacteria | 10024 |
| 43 | Ga0466709_374798 | 3300042648 | Bacteria | 4300 |
| 44 | Ga0466724_39109 | 3300042649 | Bacteria | 8826 |
| 45 | Ga0466727_078549 | 3300042655 | Bacteria | 18273 |
| 46 | Ga0466727_112583 | 3300042655 | Bacteria | 11437 |
| 47 | Ga0466727_184965 | 3300042655 | Bacteria | 11582 |
| 48 | Ga0466693_242922 | 3300042592 | Bacteria | 1568 |
| 49 | Ga0466694_065057 | 3300042594 | Bacteria | 3652 |
| 50 | Ga0466695_134956 | 3300042595 | Bacteria | 1971 |
| 51 | Ga0466696_019433 | 3300042596 | Bacteria | 8031 |
| 52 | Ga0466696_105086 | 3300042596 | Bacteria | 1065 |
| 53 | Ga0466696_279917 | 3300042596 | Bacteria | 5356 |
| 54 | Ga0466701_008497 | 3300042598 | Bacteria | 1596 |
| 55 | Ga0123356_10564820 | 3300010049 | Bacteria | 1300 |
| 56 | Ga0123354_10038189 | 3300010882 | Bacteria | 7459 |
| 57 | Ga0466711_491833 | 3300042615 | Bacteria | 2101 |
| 58 | Ga0466723_133687 | 3300042618 | Bacteria | 11953 |
| 59 | Ga0466728_162095 | 3300042620 | Bacteria | 3403 |
| 60 | Ga0466700_216950 | 3300042600 | Bacteria | 8275 |
| 61 | Ga0466700_293511 | 3300042600 | Bacteria | 1738 |
| 62 | Ga0466707_346106 | 3300042601 | Bacteria | 6136 |
| 63 | Ga0466713_088179 | 3300042602 | Bacteria | 19340 |
| 64 | Ga0466713_135582 | 3300042602 | Bacteria | 25846 |
| 65 | Ga0466722_001111 | 3300042609 | Bacteria | 7850 |
| 66 | IMNBL1DRAFT_c0006824 | 3300000062 | Bacteria | 6147 |
| 67 | JGI24702J35022_10017488 | 3300002462 | Bacteria | 3916 |
| 68 | JGI24696J40584_12945920 | 3300002834 | Bacteria | 1873 |
| 69 | Ga0068302_10023857 | 3300005071 | Bacteria | 3383 |
| 70 | Ga0068305_10044503 | 3300005083 | Bacteria | 14079 |
| 71 | Ga0103267_1000686 | 3300007190 | Bacteria | 12433 |
| 72 | Ga0123357_10000432 | 3300009784 | Bacteria | 40248 |
| 73 | Ga0466697_206024 | 3300042611 | Bacteria | 2951 |
| 74 | Ga0466705_084245 | 3300042612 | Bacteria | 30247 |
| 75 | Ga0466705_196051 | 3300042612 | Bacteria | 3937 |
| 76 | Ga0466734_023480 | 3300042623 | Bacteria | 1243 |
| 77 | Ga0466703_064298 | 3300042636 | Bacteria | 1813 |
| 78 | Ga0466704_319214 | 3300042643 | Bacteria | 10864 |
| 79 | Ga0466704_555116 | 3300042643 | Bacteria | 15667 |
| 80 | Ga0466709_086203 | 3300042648 | Bacteria | 13911 |
| 81 | Ga0466727_194296 | 3300042655 | Bacteria | 10166 |
| 82 | Ga0466656_059550 | 3300042550 | Bacteria | 1054 |
| 83 | Ga0466690_044148 | 3300042590 | Bacteria | 7727 |
| 84 | Ga0123357_10008766 | 3300009784 | Bacteria | 12680 |
| 85 | Ga0123356_10632462 | 3300010049 | Bacteria | 1236 |
| 86 | Ga0123354_10044006 | 3300010882 | Bacteria | 6855 |
| 87 | Ga0466711_115405 | 3300042615 | Bacteria | 2711 |
| 88 | Ga0466715_350833 | 3300042616 | Bacteria | 63527 |
| 89 | Ga0466715_431927 | 3300042616 | Bacteria | 29895 |
| 90 | Ga0466715_484162 | 3300042616 | Bacteria | 3625 |
| 91 | Ga0466701_085578 | 3300042598 | Unclassified | 22744 |
| 92 | Ga0466707_264940 | 3300042601 | Bacteria | 6563 |
| 93 | Ga0466716_034067 | 3300042605 | Bacteria | 12537 |
| 94 | Ga0466716_540538 | 3300042605 | Bacteria | 3592 |
| 95 | Ga0466720_197411 | 3300042607 | Bacteria | 1881 |
| 96 | 2227544074 | 2225789004 | Bacteria | 15454 |
| 97 | Ga0068305_10043536 | 3300005083 | Unclassified | 2477 |
| 98 | Ga0068305_10068380 | 3300005083 | Unclassified | 10296 |
| 99 | Ga0466705_267522 | 3300042612 | Bacteria | 42757 |
| 100 | Ga0466705_269715 | 3300042612 | Bacteria | 22152 |
| 101 | Ga0466705_331688 | 3300042612 | Bacteria | 2573 |
| 102 | Ga0466703_250238 | 3300042636 | Bacteria | 9883 |
| 103 | Ga0466704_498990 | 3300042643 | Bacteria | 20830 |
| 104 | Ga0466733_163083 | 3300042659 | Bacteria | 18853 |
| 105 | Ga0466696_423060 | 3300042596 | Bacteria | 14772 |
| 106 | Ga0123357_10008660 | 3300009784 | Bacteria | 12742 |
| 107 | Ga0123353_10467228 | 3300010167 | Unclassified | 1851 |
| 108 | Ga0123354_10008912 | 3300010882 | Bacteria | 15307 |
| 109 | Ga0123354_10186857 | 3300010882 | Bacteria | 2340 |
| 110 | Ga0466715_175294 | 3300042616 | Bacteria | 24622 |
| 111 | Ga0466723_213900 | 3300042618 | Bacteria | 6732 |
| 112 | Ga0466726_409057 | 3300042619 | Bacteria | 5702 |
| 113 | Ga0466728_165940 | 3300042620 | Bacteria | 4243 |
| 114 | Ga0466728_272294 | 3300042620 | Bacteria | 8781 |
| 115 | Ga0466700_282967 | 3300042600 | Bacteria | 2890 |
| 116 | Ga0466713_068397 | 3300042602 | Bacteria | 3098 |
| 117 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 118 | Ga0466713_113369 | 3300042602 | Bacteria | 4140 |
| 119 | Ga0466713_120182 | 3300042602 | Bacteria | 54854 |
| 120 | Ga0466717_259686 | 3300042604 | Bacteria | 3733 |
| 121 | Ga0466716_331003 | 3300042605 | Bacteria | 1241 |
| 122 | Ga0466698_175724 | 3300042610 | Bacteria | 3298 |
| 123 | 2227512153 | 2225789004 | Bacteria | 3531 |
| 124 | 2227667395 | 2225789004 | Unclassified | 1917 |
| 125 | IMNBL1DRAFT_c0002792 | 3300000062 | Bacteria | 11825 |
| 126 | JGI24702J35022_10007306 | 3300002462 | Bacteria | 6340 |
| 127 | JGI24696J40584_12957299 | 3300002834 | Bacteria | 3447 |
| 128 | Ga0104051_1107929 | 3300007078 | Bacteria | 943 |
| 129 | Ga0103267_1004184 | 3300007190 | Bacteria | 3916 |
| 130 | Ga0466697_201636 | 3300042611 | Bacteria | 1625 |
| 131 | Ga0466705_252882 | 3300042612 | Bacteria | 1646 |
| 132 | Ga0466734_054471 | 3300042623 | Bacteria | 1059 |
| 133 | Ga0466735_093465 | 3300042624 | Bacteria | 3532 |
| 134 | Ga0466735_144049 | 3300042624 | Bacteria | 1610 |
| 135 | Ga0466730_052553 | 3300042625 | Bacteria | 1390 |
| 136 | Ga0466703_075123 | 3300042636 | Bacteria | 9829 |
| 137 | Ga0466703_305819 | 3300042636 | Bacteria | 5273 |
| 138 | Ga0466709_237921 | 3300042648 | Bacteria | 101442 |
| 139 | Ga0265387_1004671 | 3300024582 | Bacteria | 1858 |
| 140 | Ga0466691_105208 | 3300042593 | Bacteria | 3132 |
| 141 | Ga0466696_130621 | 3300042596 | Bacteria | 31461 |
| 142 | Ga0466696_477302 | 3300042596 | Bacteria | 8539 |
| 143 | Ga0123353_11168726 | 3300010167 | Bacteria | 1014 |
| 144 | Ga0123354_10268539 | 3300010882 | Unclassified | 1685 |
| 145 | Ga0466711_079957 | 3300042615 | Bacteria | 8194 |
| 146 | Ga0466726_132047 | 3300042619 | Bacteria | 1294 |
| 147 | Ga0466728_076175 | 3300042620 | Bacteria | 2368 |
| 148 | Ga0466707_018104 | 3300042601 | Bacteria | 8017 |
| 149 | Ga0466707_300711 | 3300042601 | Bacteria | 3260 |
| 150 | Ga0466713_062939 | 3300042602 | Bacteria | 5560 |
| 151 | Ga0466719_174081 | 3300042606 | Bacteria | 5620 |
| 152 | Ga0466719_401571 | 3300042606 | Bacteria | 16231 |
| 153 | 2227063687 | 2225789003 | Unclassified | 17889 |
| 154 | JGI24702J35022_10046572 | 3300002462 | Bacteria | 2309 |
| 155 | JGI24705J35276_12145239 | 3300002504 | Bacteria | 1158 |
| 156 | JGI24699J35502_11134091 | 3300002509 | Bacteria | 29759 |
| 157 | Ga0068305_10826498 | 3300005083 | Bacteria | 4328 |
| 158 | Ga0102734_1000349 | 3300007129 | Bacteria | 13671 |
| 159 | Ga0104040_1143081 | 3300007149 | Bacteria | 2208 |
| 160 | Ga0103267_1000368 | 3300007190 | Bacteria | 30698 |
| 161 | Ga0466697_066144 | 3300042611 | Bacteria | 115209 |
| 162 | Ga0466703_392800 | 3300042636 | Bacteria | 1096 |
| 163 | Ga0466704_223118 | 3300042643 | Bacteria | 11656 |
| 164 | Ga0466704_259053 | 3300042643 | Bacteria | 5411 |
| 165 | Ga0466709_109865 | 3300042648 | Bacteria | 13586 |
| 166 | Ga0466724_42947 | 3300042649 | Unclassified | 1236 |
| 167 | Ga0466708_178769 | 3300042652 | Bacteria | 12715 |
| 168 | Ga0466733_026924 | 3300042659 | Bacteria | 17906 |
| 169 | Ga0466733_127865 | 3300042659 | Bacteria | 19394 |
| 170 | Ga0466733_221947 | 3300042659 | Bacteria | 3255 |
| 171 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 172 | Ga0466690_063519 | 3300042590 | Bacteria | 10879 |
| 173 | Ga0123356_10091353 | 3300010049 | Bacteria | 2902 |
| 174 | Ga0123356_10251264 | 3300010049 | Bacteria | 1846 |
| 175 | Ga0123354_10026665 | 3300010882 | Bacteria | 9114 |
| 176 | Ga0466710_073566 | 3300042613 | Bacteria | 2068 |
| 177 | Ga0466710_354941 | 3300042613 | Bacteria | 11373 |
| 178 | Ga0466710_359138 | 3300042613 | Bacteria | 5461 |
| 179 | Ga0466712_228717 | 3300042614 | Bacteria | 1085 |
| 180 | Ga0466711_402154 | 3300042615 | Bacteria | 17656 |
| 181 | Ga0466711_428622 | 3300042615 | Bacteria | 45121 |
| 182 | Ga0466715_172678 | 3300042616 | Bacteria | 13132 |
| 183 | Ga0466723_163370 | 3300042618 | Bacteria | 6537 |
| 184 | Ga0466726_243425 | 3300042619 | Bacteria | 2024 |
| 185 | Ga0466726_433676 | 3300042619 | Bacteria | 1729 |
| 186 | Ga0466728_328728 | 3300042620 | Bacteria | 22080 |
| 187 | Ga0466713_013675 | 3300042602 | Bacteria | 6989 |
| 188 | Ga0466713_059440 | 3300042602 | Bacteria | 68698 |
| 189 | Ga0466713_082474 | 3300042602 | Bacteria | 14368 |
| 190 | Ga0466713_089343 | 3300042602 | Bacteria | 3025 |
| 191 | Ga0466719_452983 | 3300042606 | Bacteria | 5073 |
| 192 | Ga0466719_491098 | 3300042606 | Bacteria | 6210 |
| 193 | Ga0466720_183266 | 3300042607 | Bacteria | 3904 |
| 194 | Ga0466722_226543 | 3300042609 | Bacteria | 1352 |
| 195 | Ga0072941_1029771 | 3300005201 | Bacteria | 5450 |
| 196 | Ga0466705_187204 | 3300042612 | Bacteria | 6402 |
| 197 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 198 | Ga0466729_220593 | 3300042621 | Bacteria | 10715 |
| 199 | Ga0466731_205737 | 3300042622 | Bacteria | 4333 |
| 200 | Ga0466735_055567 | 3300042624 | Bacteria | 1795 |
| 201 | Ga0466703_113557 | 3300042636 | Bacteria | 21378 |
| 202 | Ga0466703_399859 | 3300042636 | Bacteria | 9378 |
| 203 | Ga0466704_203713 | 3300042643 | Bacteria | 3811 |
| 204 | Ga0466704_263741 | 3300042643 | Bacteria | 1795 |
| 205 | Ga0466709_282553 | 3300042648 | Bacteria | 6053 |
| 206 | Ga0466708_094150 | 3300042652 | Bacteria | 6890 |
| 207 | Ga0466732_299398 | 3300042656 | Bacteria | 1367 |
| 208 | Ga0466733_022395 | 3300042659 | Bacteria | 8502 |
| 209 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 210 | Ga0466691_123071 | 3300042593 | Bacteria | 1048 |
| 211 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 212 | Ga0466696_466374 | 3300042596 | Bacteria | 1431 |
| 213 | Ga0123357_10021466 | 3300009784 | Bacteria | 8649 |
| 214 | Ga0123353_10964503 | 3300010167 | Bacteria | 1151 |
| 215 | Ga0123354_10001957 | 3300010882 | Bacteria | 26332 |
| 216 | Ga0123354_10003453 | 3300010882 | Bacteria | 21822 |
| 217 | Ga0466715_105491 | 3300042616 | Bacteria | 3977 |
| 218 | Ga0466715_406077 | 3300042616 | Bacteria | 6195 |
| 219 | Ga0466715_543556 | 3300042616 | Bacteria | 8520 |
| 220 | Ga0466723_098936 | 3300042618 | Bacteria | 4793 |
| 221 | Ga0466723_111722 | 3300042618 | Bacteria | 2410 |
| 222 | Ga0466726_008637 | 3300042619 | Bacteria | 3211 |
| 223 | Ga0466728_377127 | 3300042620 | Bacteria | 9451 |
| 224 | Ga0466729_186810 | 3300042621 | Bacteria | 4233 |
| 225 | Ga0466707_164596 | 3300042601 | Bacteria | 3930 |
| 226 | Ga0466707_352225 | 3300042601 | Bacteria | 3624 |
| 227 | Ga0466713_096540 | 3300042602 | Bacteria | 5082 |
| 228 | Ga0466716_278193 | 3300042605 | Bacteria | 1091 |
| 229 | Ga0466720_013168 | 3300042607 | Bacteria | 1528 |
| 230 | Ga0466720_213363 | 3300042607 | Bacteria | 1314 |
| 231 | 2227264121 | 2225789004 | Bacteria | 6982 |
| 232 | IMNBL1DRAFT_c0005896 | 3300000062 | Bacteria | 6865 |
| 233 | JGI24702J35022_10017524 | 3300002462 | Bacteria | 3913 |
| 234 | JGI24702J35022_10209340 | 3300002462 | Bacteria | 1119 |
| 235 | JGI24699J35502_11113581 | 3300002509 | Bacteria | 2817 |
| 236 | Ga0103265_1000663 | 3300007068 | Bacteria | 5777 |
| 237 | Ga0102737_1000206 | 3300007142 | Bacteria | 20194 |
| 238 | Ga0123357_10002448 | 3300009784 | Bacteria | 20711 |
| 239 | Ga0466705_094404 | 3300042612 | Bacteria | 3692 |
| 240 | Ga0466735_107337 | 3300042624 | Bacteria | 4298 |
| 241 | Ga0466735_200979 | 3300042624 | Bacteria | 5294 |
| 242 | Ga0466704_155246 | 3300042643 | Bacteria | 56044 |
| 243 | Ga0466704_197346 | 3300042643 | Bacteria | 3773 |
| 244 | Ga0466727_229944 | 3300042655 | Bacteria | 5448 |
| 245 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 246 | Ga0466733_170460 | 3300042659 | Bacteria | 186955 |
| 247 | Ga0466690_212849 | 3300042590 | Bacteria | 8332 |
| 248 | Ga0466690_417542 | 3300042590 | Bacteria | 16428 |
| 249 | Ga0466691_038674 | 3300042593 | Bacteria | 2746 |
| 250 | Ga0466691_162368 | 3300042593 | Bacteria | 5311 |
| 251 | Ga0466691_172485 | 3300042593 | Bacteria | 7384 |
| 252 | Ga0466696_053219 | 3300042596 | Bacteria | 4317 |
| 253 | Ga0123357_10021662 | 3300009784 | Bacteria | 8604 |
| 254 | Ga0123357_10297348 | 3300009784 | Bacteria | 1637 |
| 255 | Ga0123356_10021587 | 3300010049 | Bacteria | 6077 |
| 256 | Ga0123353_10624761 | 3300010167 | Bacteria | 1532 |
| 257 | Ga0123354_10012047 | 3300010882 | Bacteria | 13384 |
| 258 | Ga0123354_10174884 | 3300010882 | Bacteria | 2480 |
| 259 | Ga0123354_10203794 | 3300010882 | Bacteria | 2164 |
| 260 | Ga0466723_043743 | 3300042618 | Bacteria | 4728 |
| 261 | Ga0466723_119594 | 3300042618 | Bacteria | 17828 |
| 262 | Ga0466723_151916 | 3300042618 | Bacteria | 8806 |
| 263 | Ga0466726_396983 | 3300042619 | Bacteria | 7725 |
| 264 | Ga0466728_416052 | 3300042620 | Bacteria | 4354 |
| 265 | Ga0466700_047546 | 3300042600 | Bacteria | 23188 |
| 266 | Ga0466707_084311 | 3300042601 | Bacteria | 25241 |
| 267 | Ga0466717_153938 | 3300042604 | Bacteria | 2330 |
| 268 | Ga0466716_031980 | 3300042605 | Bacteria | 2740 |
| 269 | Ga0466722_156350 | 3300042609 | Bacteria | 15490 |
| 270 | IMNBL1DRAFT_c0002728 | 3300000062 | Bacteria | 12024 |
| 271 | JGI24695J34938_10072334 | 3300002450 | Bacteria | 1438 |
| 272 | JGI24702J35022_10189212 | 3300002462 | Bacteria | 1173 |
| 273 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 274 | Ga0068305_10128933 | 3300005083 | Bacteria | 11962 |
| 275 | Ga0123357_10002994 | 3300009784 | Bacteria | 19122 |
| 276 | Ga0466705_178173 | 3300042612 | Bacteria | 18747 |
| 277 | Ga0466705_286413 | 3300042612 | Bacteria | 5654 |
| 278 | Ga0466735_042850 | 3300042624 | Bacteria | 1647 |
| 279 | Ga0466735_178648 | 3300042624 | Bacteria | 2697 |
| 280 | Ga0466735_213805 | 3300042624 | Bacteria | 2297 |
| 281 | Ga0466703_155147 | 3300042636 | Unclassified | 1303 |
| 282 | Ga0466704_096202 | 3300042643 | Bacteria | 11417 |
| 283 | Ga0466709_001911 | 3300042648 | Bacteria | 9662 |
| 284 | Ga0466709_393150 | 3300042648 | Bacteria | 88757 |
| 285 | Ga0466727_165684 | 3300042655 | Bacteria | 4184 |
| 286 | Ga0466727_336283 | 3300042655 | Bacteria | 5614 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.