Protein Family IF02167

Metagenome Isolate
162 Members
83 Samples
123 Scaffolds
482.83 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10002825|Ga0123357_1000282510
Length
556 aa
Sequence
MEISLAELALRPDSAVPAGSPGGLPNGPNPLHLLSKPHSCDNAQRRAQVRLPAENSKRNRTSPGRGVNHKVAIMAKVDLYSGEFLPLEMHKVRIVQKLNLPPIEDRLKAIAAAGNNTFLLNTDDVFLDMLTDSGVNAMSDQQLAAMMVADDAYAGSATYTRLANKLRDIFGMDYFLPTHQGRACENILAQTYVKPGMVTLMNFHFTTTKAHITLNGGVVEELVAASGLEVNSTLPFKGDIDIARLEASIARHGTEKIAFMRVESGTNLIGGQPISLANLAEVRKVCSRHGILLVLDASLLADNLHFNKTREESCKNLSIREITRRTADLCDIIYFSARKLGCARGGGICIRDESVYLRMRALVPLYEGFLTYGGMSVREMEALTVGLEETMDEDMINQGPHFIRAMVDELDRRGIPVITPAGGLGCHLNAMRFVDHIPQSQYPAGALGAAMYIAGAIRGMERGTLSEQRNPDGSELFATMELLRLALPRRVFTLSQIKYAIDRIQWLYDNRGLIGGLEFVEEPEVLRFFYGRLKPVSDWQEKLAAKFRNDLGDSL*

📊 Sample Types

Isolate 24.1%
Metagenome 75.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.0%
Termitidae 32.5%
Kalotermitidae 13.3%
Termopsidae 4.8%
Rhinotermitidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 17
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190994 Unclassified Bathyarchaeota Lab288P3bin169 Isolate Unclassified
2 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
3 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
4 2820462123 Unclassified Firmicutes Lab288P3bin129 Isolate Unclassified
5 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
6 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
12 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
13 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
14 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 2772191000 Unclassified Bathyarchaeota Nt197P4bin22 Isolate Unclassified
18 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
22 2772190992 Unclassified Bathyarchaeota Emb289P3bin80 Isolate Unclassified
23 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
24 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
25 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
33 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
34 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
35 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
36 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
37 2820438595 Unclassified Firmicutes Lab288P3bin208 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 2772190974 Unclassified Bathyarchaeota Co191P3bin4 Isolate Unclassified
43 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
44 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
45 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
46 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2772190976 Unclassified Bathyarchaeota Co191P4bin18 Isolate Unclassified
52 2772190989 Unclassified Bathyarchaeota Cu122P1bin20 Isolate Unclassified
53 2772190990 Unclassified Bathyarchaeota Emb289P1bin127 Isolate Unclassified
54 2772190998 Unclassified Bathyarchaeota Nc150P4bin1 Isolate Unclassified
55 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
56 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
57 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
58 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
59 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
60 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
61 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
62 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
63 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
64 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
65 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
66 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
67 2772190999 Unclassified Bathyarchaeota Nc150P3bin14 Isolate Unclassified
68 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
69 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
70 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
71 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
72 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
73 2772190988 Unclassified Bathyarchaeota Co191P1bin46 Isolate Unclassified
74 2772190991 Unclassified Bathyarchaeota Emb289P3bin109 Isolate Unclassified
75 2772190996 Unclassified Bathyarchaeota Lab288P4bin61 Isolate Unclassified
76 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
77 2820485985 Unclassified Firmicutes Lab288P1bin73 Isolate Unclassified
78 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
79 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
80 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
81 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
82 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
83 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_333386 3300042605 Bacteria 13482
2 Ga0466716_510739 3300042605 Bacteria 2146
3 Ga0123357_10249519 3300009784 Bacteria 1903
4 Ga0123356_10000069 3300010049 Bacteria 108106
5 Ga0123353_10006386 3300010167 Bacteria 15684
6 Ga0123353_10471302 3300010167 Bacteria 1841
7 Ga0466694_079901 3300042594 Archaea 68884
8 Ga0466718_122602 3300042617 Unclassified 2180
9 JGI24705J35276_12237114 3300002504 Unclassified 9870
10 Ga0466703_188016 3300042636 Bacteria 4512
11 Ga0466704_045625 3300042643 Unclassified 1474
12 Ga0466704_448181 3300042643 Bacteria 4323
13 Ga0466727_041522 3300042655 Bacteria 2133
14 Ga0123356_10003039 3300010049 Unclassified 17719
15 Ga0123353_10045573 3300010167 Bacteria 6960
16 Ga0415639_078226 3300038395 Bacteria 2257
17 Ga0415639_087567 3300038395 Bacteria 2833
18 Ga0466691_137100 3300042593 Bacteria 1740
19 Ga0466715_064229 3300042616 Bacteria 47985
20 Ga0466723_002996 3300042618 Bacteria 25855
21 Ga0466723_057696 3300042618 Bacteria 16864
22 Ga0466723_116648 3300042618 Unclassified 3409
23 Ga0466726_429748 3300042619 Bacteria 3208
24 JGI24702J35022_10008356 3300002462 Bacteria 5863
25 JGI24702J35022_10057661 3300002462 Bacteria 2073
26 Ga0123357_10002825 3300009784 Bacteria 19594
27 Ga0466697_183410 3300042611 Bacteria 2166
28 Ga0466697_218549 3300042611 Archaea 2798
29 Ga0466735_176109 3300042624 Bacteria 8872
30 Ga0466704_016937 3300042643 Bacteria 9186
31 Ga0466727_094882 3300042655 Bacteria 3845
32 Ga0466733_144538 3300042659 Bacteria 8101
33 Ga0466706_066430 3300042599 Bacteria 19494
34 Ga0123356_10002352 3300010049 Unclassified 20300
35 Ga0123356_10008415 3300010049 Bacteria 10258
36 Ga0123353_10019032 3300010167 Bacteria 10187
37 Ga0466715_059458 3300042616 Bacteria 5247
38 Ga0466715_362039 3300042616 Bacteria 2689
39 Ga0466726_028084 3300042619 Bacteria 6077
40 Ga0466728_271511 3300042620 Bacteria 6736
41 JGI24702J35022_10027637 3300002462 Bacteria 3051
42 JGI24705J35276_12237704 3300002504 Bacteria 12653
43 JGI24696J40584_12961538 3300002834 Bacteria 20174
44 Ga0466705_200246 3300042612 Bacteria 71691
45 Ga0466714_001063 3300042603 Bacteria 2007
46 Ga0466714_154484 3300042603 Bacteria 3586
47 Ga0466720_049991 3300042607 Bacteria 2754
48 Ga0123356_10000868 3300010049 Bacteria 33541
49 Ga0123353_10000237 3300010167 Bacteria 69845
50 Ga0415639_081387 3300038395 Unclassified 1748
51 Ga0466693_137231 3300042592 Bacteria 7509
52 Ga0466696_075406 3300042596 Bacteria 14898
53 Ga0466710_176070 3300042613 Bacteria 17789
54 Ga0466715_014540 3300042616 Bacteria 6944
55 Ga0466715_056101 3300042616 Bacteria 8351
56 Ga0466726_301029 3300042619 Bacteria 17227
57 Ga0466728_300254 3300042620 Bacteria 2542
58 Ga0068302_10008463 3300005071 Bacteria 8881
59 Ga0466705_378104 3300042612 Bacteria 23152
60 Ga0466731_104929 3300042622 Bacteria 2878
61 Ga0466703_079021 3300042636 Bacteria 2973
62 Ga0466704_024191 3300042643 Bacteria 12467
63 Ga0466708_366221 3300042652 Bacteria 9159
64 Ga0466700_008134 3300042600 Bacteria 2324
65 Ga0466716_503538 3300042605 Bacteria 1563
66 Ga0123355_10107662 3300009826 Bacteria 4366
67 Ga0123356_10003149 3300010049 Unclassified 17358
68 Ga0123356_10172968 3300010049 Bacteria 2173
69 Ga0123353_10051393 3300010167 Bacteria 6576
70 Ga0466657_047435 3300042582 Bacteria 6536
71 Ga0466691_150530 3300042593 Bacteria 10297
72 Ga0466705_405654 3300042612 Bacteria 24935
73 Ga0466710_223889 3300042613 Bacteria 4455
74 Ga0466723_053515 3300042618 Bacteria 12941
75 Ga0466728_142896 3300042620 Bacteria 5884
76 JGI24702J35022_10047425 3300002462 Bacteria 2287
77 JGI24705J35276_12238655 3300002504 Unclassified 32488
78 Ga0466734_000366 3300042623 Bacteria 4485
79 Ga0466717_052424 3300042604 Archaea 3910
80 Ga0466712_188585 3300042614 Bacteria 2125
81 Ga0466711_420703 3300042615 Bacteria 23893
82 Ga0466715_080091 3300042616 Bacteria 2402
83 Ga0466715_559782 3300042616 Bacteria 2369
84 Ga0466723_055653 3300042618 Bacteria 17673
85 Ga0466728_070979 3300042620 Bacteria 4330
86 Ga0466728_213326 3300042620 Bacteria 2447
87 Ga0072940_1089689 3300005200 Bacteria 1988
88 Ga0466733_106701 3300042659 Bacteria 30778
89 Ga0466701_061770 3300042598 Bacteria 8204
90 Ga0466717_138070 3300042604 Unclassified 8128
91 Ga0466721_355839 3300042608 Bacteria 31930
92 Ga0123355_10219239 3300009826 Bacteria 2740
93 Ga0123353_10357855 3300010167 Bacteria 2195
94 Ga0466692_046037 3300042591 Bacteria 15679
95 Ga0466695_345612 3300042595 Bacteria 2067
96 Ga0466696_130103 3300042596 Bacteria 13383
97 Ga0466712_014507 3300042614 Bacteria 28821
98 Ga0466723_054120 3300042618 Bacteria 26199
99 Ga0466723_266671 3300042618 Bacteria 14508
100 Ga0466726_048771 3300042619 Unclassified 2013
101 Ga0466728_327491 3300042620 Bacteria 1973
102 Ga0068302_10000491 3300005071 Bacteria 5097
103 Ga0466705_031835 3300042612 Bacteria 10730
104 Ga0466705_330695 3300042612 Bacteria 5876
105 Ga0466708_092265 3300042652 Bacteria 2350
106 Ga0466714_078986 3300042603 Bacteria 2477
107 Ga0466717_137183 3300042604 Unclassified 2125
108 Ga0123355_10001000 3300009826 Bacteria 39240
109 Ga0123355_10027222 3300009826 Bacteria 9232
110 Ga0123356_10008296 3300010049 Bacteria 10334
111 Ga0123353_10006016 3300010167 Bacteria 16070
112 Ga0123353_10040217 3300010167 Bacteria 7375
113 Ga0123353_10083943 3300010167 Bacteria 5127
114 Ga0123353_10102512 3300010167 Bacteria 4613
115 Ga0123353_10159475 3300010167 Bacteria 3593
116 Ga0123353_10164707 3300010167 Bacteria 3526
117 Ga0466656_385882 3300042550 Bacteria 3361
118 Ga0466657_296548 3300042582 Archaea 15127
119 Ga0466715_372080 3300042616 Bacteria 15374
120 Ga0466726_015650 3300042619 Bacteria 6791
121 JGI24702J35022_10002868 3300002462 Bacteria 10441
122 Ga0466697_176770 3300042611 Archaea 2092
123 Ga0466708_098775 3300042652 Bacteria 48939

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_137183 Ga0466717_137183_915_2096 393
2 iso_pu_archaea 2772190989 2773777680 452
3 3300038395 Ga0415639_087567 Ga0415639_087567_10_1377 455
4 3300042624 Ga0466735_176109 Ga0466735_176109_6395_7837 460
5 3300010167 Ga0123353_10045573 Ga0123353_100455738 462
6 3300042605 Ga0466716_333386 Ga0466716_333386_8991_10379 462
7 3300042614 Ga0466712_014507 Ga0466712_014507_17393_18781 462
8 3300042643 Ga0466704_045625 Ga0466704_045625_33_1427 464
9 3300042600 Ga0466700_008134 Ga0466700_008134_552_1955 467
10 3300042605 Ga0466716_510739 Ga0466716_510739_93_1496 467
11 3300042608 Ga0466721_355839 Ga0466721_355839_18432_19835 467
12 3300042614 Ga0466712_188585 Ga0466712_188585_503_1906 467
13 3300042618 Ga0466723_266671 Ga0466723_266671_3667_5070 467
14 iso_pr_bacteria 2820086750 2820088150 467
15 iso_pr_bacteria 2857493320 2857495792 467
16 iso_pr_bacteria 2857498920 2857501359 467
17 3300010049 Ga0123356_10172968 Ga0123356_101729681 472
18 iso_pr_bacteria 2820485985 2820486412 472
19 3300042618 Ga0466723_053515 Ga0466723_053515_8371_9834 473
20 3300010167 Ga0123353_10102512 Ga0123353_101025123 474
21 3300042616 Ga0466715_056101 Ga0466715_056101_4380_5843 474
22 3300042582 Ga0466657_296548 Ga0466657_296548_6066_7496 476
23 3300042612 Ga0466705_330695 Ga0466705_330695_3365_4807 480
24 3300042612 Ga0466705_405654 Ga0466705_405654_2183_3625 480
25 3300042643 Ga0466704_016937 Ga0466704_016937_4885_6327 480
26 3300009826 Ga0123355_10027222 Ga0123355_100272226 481
27 3300009826 Ga0123355_10219239 Ga0123355_102192391 481
28 3300010167 Ga0123353_10019032 Ga0123353_100190326 481
29 3300010167 Ga0123353_10040217 Ga0123353_100402172 481
30 3300042603 Ga0466714_001063 Ga0466714_001063_240_1685 481
31 iso_pr_bacteria 2781125639 2781286927 481
32 iso_pr_bacteria 2820005795 2820007178 481
33 iso_pr_bacteria 2820462123 2820463258 481
34 iso_pr_bacteria 2820464928 2820464933 481
35 3300010167 Ga0123353_10000237 Ga0123353_100002376 482
36 3300010167 Ga0123353_10159475 Ga0123353_101594753 482
37 3300038395 Ga0415639_078226 Ga0415639_078226_57_1505 482
38 3300038395 Ga0415639_081387 Ga0415639_081387_282_1730 482
39 3300042550 Ga0466656_385882 Ga0466656_385882_693_2141 482
40 3300042591 Ga0466692_046037 Ga0466692_046037_7371_8819 482
41 3300042592 Ga0466693_137231 Ga0466693_137231_4212_5660 482
42 3300042593 Ga0466691_137100 Ga0466691_137100_148_1596 482
43 3300042594 Ga0466694_079901 Ga0466694_079901_24126_25574 482
44 3300042596 Ga0466696_130103 Ga0466696_130103_6290_7738 482
45 3300042598 Ga0466701_061770 Ga0466701_061770_3024_4472 482
46 3300042603 Ga0466714_078986 Ga0466714_078986_337_1785 482
47 3300042603 Ga0466714_154484 Ga0466714_154484_2031_3479 482
48 3300042604 Ga0466717_052424 Ga0466717_052424_2222_3670 482
49 3300042604 Ga0466717_138070 Ga0466717_138070_799_2247 482
50 3300042611 Ga0466697_176770 Ga0466697_176770_268_1716 482
51 3300042611 Ga0466697_218549 Ga0466697_218549_577_2025 482
52 3300042616 Ga0466715_064229 Ga0466715_064229_27355_28803 482
53 3300042616 Ga0466715_372080 Ga0466715_372080_10750_12198 482
54 3300042616 Ga0466715_559782 Ga0466715_559782_615_2063 482
55 3300042617 Ga0466718_122602 Ga0466718_122602_616_2064 482
56 3300042618 Ga0466723_054120 Ga0466723_054120_13558_15006 482
57 3300042619 Ga0466726_015650 Ga0466726_015650_313_1761 482
58 3300042619 Ga0466726_301029 Ga0466726_301029_10434_11882 482
59 3300042622 Ga0466731_104929 Ga0466731_104929_332_1780 482
60 3300042655 Ga0466727_041522 Ga0466727_041522_210_1658 482
61 3300042659 Ga0466733_144538 Ga0466733_144538_5507_6955 482
62 iso_pr_bacteria 2518285616 2518642255 482
63 iso_pr_bacteria 2772190895 2773441105 482
64 iso_pr_bacteria 2820084079 2820084434 482
65 iso_pr_bacteria 2820115951 2820119250 482
66 iso_pr_bacteria 2820244222 2820246567 482
67 iso_pr_bacteria 2820280018 2820282699 482
68 iso_pr_bacteria 2820333861 2820334041 482
69 iso_pr_bacteria 2820360414 2820361453 482
70 iso_pr_bacteria 2820438595 2820438761 482
71 iso_pr_bacteria 2820611732 2820611996 482
72 iso_pr_bacteria 2820911766 2820911911 482
73 iso_pu_archaea 2772190974 2773719710 482
74 iso_pu_archaea 2772190976 2773726480 482
75 iso_pu_archaea 2772190988 2773775861 482
76 iso_pu_archaea 2772190990 2773780360 482
77 iso_pu_archaea 2772190991 2773782516 482
78 iso_pu_archaea 2772190992 2773784255 482
79 iso_pu_archaea 2772190994 2773786936 482
80 iso_pu_archaea 2772190996 2773790510 482
81 iso_pu_archaea 2772190998 2773795578 482
82 iso_pu_archaea 2772190999 2773796596 482
83 iso_pu_archaea 2772191000 2773798014 482
84 3300002462 JGI24702J35022_10002868 JGI24702J35022_100028689 483
85 3300002462 JGI24702J35022_10008356 JGI24702J35022_100083563 483
86 3300002462 JGI24702J35022_10027637 JGI24702J35022_100276372 483
87 3300002504 JGI24705J35276_12237114 JGI24705J35276_122371146 483
88 3300002504 JGI24705J35276_12238655 JGI24705J35276_1223865513 483
89 3300002834 JGI24696J40584_12961538 JGI24696J40584_129615383 483
90 3300005071 Ga0068302_10000491 Ga0068302_100004912 483
91 3300005200 Ga0072940_1089689 Ga0072940_10896892 483
92 3300009784 Ga0123357_10249519 Ga0123357_102495191 483
93 3300009826 Ga0123355_10001000 Ga0123355_100010006 483
94 3300009826 Ga0123355_10107662 Ga0123355_101076622 483
95 3300010049 Ga0123356_10000868 Ga0123356_1000086820 483
96 3300010049 Ga0123356_10003039 Ga0123356_100030392 483
97 3300010049 Ga0123356_10003149 Ga0123356_100031497 483
98 3300010049 Ga0123356_10008296 Ga0123356_100082966 483
99 3300010167 Ga0123353_10006016 Ga0123353_100060166 483
100 3300010167 Ga0123353_10006386 Ga0123353_1000638611 483
101 3300010167 Ga0123353_10051393 Ga0123353_100513931 483
102 3300010167 Ga0123353_10083943 Ga0123353_100839434 483
103 3300010167 Ga0123353_10164707 Ga0123353_101647073 483
104 3300010167 Ga0123353_10357855 Ga0123353_103578552 483
105 3300010167 Ga0123353_10471302 Ga0123353_104713022 483
106 iso_pr_bacteria 2820185449 2820187700 483
107 iso_pr_bacteria 2820373881 2820373996 483
108 3300002462 JGI24702J35022_10047425 JGI24702J35022_100474252 484
109 3300002462 JGI24702J35022_10057661 JGI24702J35022_100576611 484
110 3300042596 Ga0466696_075406 Ga0466696_075406_12683_14137 484
111 3300042599 Ga0466706_066430 Ga0466706_066430_8535_9989 484
112 3300042612 Ga0466705_031835 Ga0466705_031835_9058_10512 484
113 3300042616 Ga0466715_080091 Ga0466715_080091_311_1765 484
114 3300042619 Ga0466726_048771 Ga0466726_048771_442_1896 484
115 3300042620 Ga0466728_300254 Ga0466728_300254_187_1641 484
116 3300042655 Ga0466727_094882 Ga0466727_094882_825_2279 484
117 iso_pr_bacteria 2820059968 2820061953 484
118 3300002504 JGI24705J35276_12237704 JGI24705J35276_122377042 485
119 3300005071 Ga0068302_10008463 Ga0068302_100084638 485
120 3300042619 Ga0466726_429748 Ga0466726_429748_420_1877 485
121 3300010049 Ga0123356_10002352 Ga0123356_1000235212 486
122 3300042582 Ga0466657_047435 Ga0466657_047435_3722_5185 487
123 3300042607 Ga0466720_049991 Ga0466720_049991_1070_2533 487
124 3300042612 Ga0466705_200246 Ga0466705_200246_11152_12615 487
125 3300042615 Ga0466711_420703 Ga0466711_420703_17363_18826 487
126 3300042616 Ga0466715_014540 Ga0466715_014540_2964_4427 487
127 3300042618 Ga0466723_002996 Ga0466723_002996_154_1617 487
128 3300042620 Ga0466728_070979 Ga0466728_070979_2414_3877 487
129 3300042620 Ga0466728_213326 Ga0466728_213326_579_2042 487
130 3300042620 Ga0466728_271511 Ga0466728_271511_3270_4733 487
131 3300042636 Ga0466703_079021 Ga0466703_079021_1309_2772 487
132 3300042636 Ga0466703_188016 Ga0466703_188016_803_2266 487
133 3300042643 Ga0466704_024191 Ga0466704_024191_8347_9810 487
134 3300042652 Ga0466708_098775 Ga0466708_098775_11175_12638 487
135 3300042659 Ga0466733_106701 Ga0466733_106701_17560_19023 487
136 3300042595 Ga0466695_345612 Ga0466695_345612_223_1689 488
137 3300042605 Ga0466716_503538 Ga0466716_503538_11_1477 488
138 3300042616 Ga0466715_059458 Ga0466715_059458_2445_3911 488
139 3300042593 Ga0466691_150530 Ga0466691_150530_6259_7728 489
140 3300042612 Ga0466705_378104 Ga0466705_378104_7009_8478 489
141 3300042616 Ga0466715_362039 Ga0466715_362039_698_2167 489
142 3300042618 Ga0466723_055653 Ga0466723_055653_14285_15754 489
143 3300042618 Ga0466723_057696 Ga0466723_057696_179_1648 489
144 3300042618 Ga0466723_116648 Ga0466723_116648_1186_2655 489
145 3300042620 Ga0466728_142896 Ga0466728_142896_2946_4415 489
146 3300042652 Ga0466708_092265 Ga0466708_092265_804_2273 489
147 3300042611 Ga0466697_183410 Ga0466697_183410_426_1901 491
148 3300042643 Ga0466704_448181 Ga0466704_448181_205_1680 491
149 3300042620 Ga0466728_327491 Ga0466728_327491_52_1530 492
150 3300042652 Ga0466708_366221 Ga0466708_366221_4301_5779 492
151 iso_pr_bacteria 2639763185 2642345663 493
152 iso_pr_bacteria 2639763186 2642350572 493
153 3300042613 Ga0466710_176070 Ga0466710_176070_10364_11848 494
154 3300042619 Ga0466726_028084 Ga0466726_028084_4436_5929 497
155 3300042623 Ga0466734_000366 Ga0466734_000366_2057_3550 497
156 iso_pr_bacteria 2820822094 2820822277 513
157 iso_pr_bacteria 2820924633 2820924853 513
158 iso_pr_bacteria 2820950349 2820950806 513
159 3300010049 Ga0123356_10000069 Ga0123356_1000006950 514
160 3300010049 Ga0123356_10008415 Ga0123356_100084151 514
161 3300042613 Ga0466710_223889 Ga0466710_223889_2214_3758 514
162 3300009784 Ga0123357_10002825 Ga0123357_1000282510 556

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01212 Beta_elim_lyase Beta-eliminating lyase 128 498 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.