Protein Family IF02162

Metagenome Isolate
289 Members
75 Samples
258 Scaffolds
585.59 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10001250|Ga0123357_100012507
Length
641 aa
Sequence
MNSLLCYLNNLFLFVLFFKKYSNVLRRNRCFSLNKVLILQQNKSFFFMAKDIKFSLVYRDMWQSSGKYQPRVDQLQQIAPVIIEMGCFSRVETNGGAFEQVNLLFGENPNKAVREFTAPFNRVGIQTHMLDRGLNGLRMNPVPSDVRKLMYRVKHAQGVDITRIFCGLNDVRNIIASIQYAKEGGMIPQAALCITYSPIHTVEYYVNMAEQLIEAGAEEICLKDMAGIGRPYSIGQIIKGIKTRHPNIPVQYHGHTGPGFSVASMLEAAKNGVDYLDTAIEPLAWGMVHPDVITIQAMLKDAGFSVPDINMEAYMEARRLTQEFVDDFLGFFIDPSNKIMTSLLVGCGLPGGMMXXXXADLKGMHNAINMALKQKGKKEVTLNYLVVQLFKEVETIWPMLGYPPLVTPFSQYVKNIALMNILANAKDEPRFSMIDKDSWNMILGKMGKLPGPLAPEIIELAKANQLEFYEGDPQLPFPDDLERFRQEMQANGWDVGQDEEELFEFAMHERQYRDMRSGAAKNRFNQELEQAKEKAGTPIIVKRPVVEIPMFSFEEISKEYPSAKPVHAPCKGQVIWQYDLMDESTAPFEGATIKKGDNLCYIQNFYGIEPVVAGYGGTIVGTYVDQGKEVQKGEILAFIN*

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.3%
Termitidae 21.3%
Kalotermitidae 18.7%
Blattidae 13.3%
Rhinotermitidae 8.0%
Termopsidae 5.3%
Passalidae 2.7%
Hydrophilidae 2.7%
Hodotermitidae 1.3%
Tenebrionidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 263
Eukaryota 0
Viruses 0
Unclassified 26

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
2 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
3 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
10 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
11 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
14 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
15 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
16 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
25 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
26 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
27 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
28 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
29 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
37 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
38 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
45 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
46 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
49 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
50 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
57 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
58 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
59 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
60 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
68 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
69 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
70 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
71 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
74 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
75 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_241367 3300042611 Bacteria 4950
2 Ga0466705_370133 3300042612 Bacteria 27217
3 Ga0466734_118779 3300042623 Bacteria 3737
4 Ga0466735_060204 3300042624 Bacteria 2324
5 Ga0466735_236402 3300042624 Bacteria 19085
6 Ga0466709_304600 3300042648 Bacteria 78097
7 Ga0466705_486192 3300042612 Bacteria 7879
8 Ga0466705_501131 3300042612 Bacteria 11074
9 Ga0466711_070398 3300042615 Bacteria 7205
10 Ga0466723_062056 3300042618 Bacteria 9021
11 Ga0466726_193064 3300042619 Bacteria 3985
12 Ga0466728_186666 3300042620 Bacteria 4409
13 Ga0466728_241888 3300042620 Bacteria 7830
14 Ga0466728_251123 3300042620 Bacteria 15910
15 Ga0466691_016050 3300042593 Unclassified 3877
16 Ga0466691_024608 3300042593 Unclassified 7578
17 Ga0466696_077676 3300042596 Bacteria 6058
18 Ga0123353_10264631 3300010167 Bacteria 2653
19 Ga0123354_10151909 3300010882 Bacteria 2801
20 2227495749 2225789004 Bacteria 3943
21 JGI24702J35022_10002610 3300002462 Bacteria 10942
22 Ga0123357_10001276 3300009784 Bacteria 26508
23 Ga0466706_085435 3300042599 Bacteria 6567
24 Ga0466719_249665 3300042606 Bacteria 5458
25 Ga0466733_054986 3300042659 Bacteria 147644
26 Ga0466729_283608 3300042621 Bacteria 7541
27 Ga0466735_017028 3300042624 Bacteria 3265
28 Ga0466703_078685 3300042636 Bacteria 15261
29 Ga0466703_150635 3300042636 Unclassified 3183
30 Ga0466703_413604 3300042636 Bacteria 28970
31 Ga0466709_080554 3300042648 Bacteria 4971
32 Ga0466727_026885 3300042655 Bacteria 2429
33 Ga0466727_079328 3300042655 Bacteria 2070
34 Ga0466727_279633 3300042655 Bacteria 7357
35 Ga0466727_302401 3300042655 Bacteria 4361
36 Ga0466711_062465 3300042615 Bacteria 8539
37 Ga0466711_510731 3300042615 Bacteria 3284
38 Ga0466715_054657 3300042616 Bacteria 5095
39 Ga0466715_206964 3300042616 Bacteria 26549
40 Ga0466723_195894 3300042618 Unclassified 23093
41 Ga0466723_235253 3300042618 Bacteria 37976
42 Ga0466726_141457 3300042619 Bacteria 39794
43 Ga0466726_167734 3300042619 Bacteria 1900
44 Ga0466728_306446 3300042620 Bacteria 59155
45 Ga0466690_046603 3300042590 Unclassified 10894
46 Ga0466690_140446 3300042590 Bacteria 6522
47 Ga0466691_145626 3300042593 Bacteria 15171
48 Ga0123356_10144471 3300010049 Bacteria 2352
49 Ga0123353_10338554 3300010167 Bacteria 2273
50 IMNBL1DRAFT_c0003857 3300000062 Bacteria 9326
51 JGI24699J35502_11133980 3300002509 Bacteria 22458
52 Ga0072940_1199710 3300005200 Bacteria 2197
53 Ga0123357_10001250 3300009784 Bacteria 26711
54 Ga0466701_078298 3300042598 Bacteria 25171
55 Ga0466706_274726 3300042599 Bacteria 13071
56 Ga0466700_073038 3300042600 Bacteria 4446
57 Ga0466700_274720 3300042600 Bacteria 7017
58 Ga0466713_109180 3300042602 Bacteria 24782
59 Ga0466716_073899 3300042605 Unclassified 8040
60 Ga0466705_083470 3300042612 Bacteria 2908
61 Ga0466703_320865 3300042636 Bacteria 24807
62 Ga0466704_414875 3300042643 Bacteria 2958
63 Ga0466709_035419 3300042648 Unclassified 5286
64 Ga0466708_182967 3300042652 Bacteria 7772
65 Ga0466708_273103 3300042652 Bacteria 14198
66 Ga0466708_401848 3300042652 Bacteria 33683
67 Ga0466727_106023 3300042655 Bacteria 80602
68 Ga0466705_454783 3300042612 Bacteria 3097
69 Ga0466715_250602 3300042616 Bacteria 9991
70 Ga0466715_283650 3300042616 Bacteria 18090
71 Ga0466692_003163 3300042591 Bacteria 29715
72 Ga0466691_042513 3300042593 Bacteria 4023
73 Ga0123354_10000449 3300010882 Bacteria 40514
74 2227465207 2225789004 Unclassified 5198
75 JGI24702J35022_10025671 3300002462 Bacteria 3177
76 JGI24699J35502_11121850 3300002509 Bacteria 3378
77 Ga0123357_10000677 3300009784 Bacteria 34044
78 Ga0466706_026587 3300042599 Bacteria 3769
79 Ga0466706_031068 3300042599 Bacteria 5253
80 Ga0466706_193330 3300042599 Bacteria 18105
81 Ga0466707_029407 3300042601 Bacteria 10212
82 Ga0466707_223370 3300042601 Unclassified 12129
83 Ga0466713_093227 3300042602 Bacteria 44477
84 Ga0466722_258628 3300042609 Bacteria 9322
85 Ga0466735_012618 3300042624 Bacteria 2258
86 Ga0466735_137384 3300042624 Bacteria 3752
87 Ga0466704_181042 3300042643 Bacteria 10001
88 Ga0466709_007217 3300042648 Bacteria 5452
89 Ga0466708_044312 3300042652 Bacteria 69817
90 Ga0466727_082564 3300042655 Bacteria 2816
91 Ga0466715_396233 3300042616 Bacteria 3598
92 Ga0466715_422584 3300042616 Unclassified 17634
93 Ga0466715_636999 3300042616 Bacteria 6226
94 Ga0466723_049071 3300042618 Unclassified 7130
95 Ga0466723_174600 3300042618 Unclassified 13352
96 Ga0466690_298906 3300042590 Bacteria 7992
97 Ga0466692_091654 3300042591 Unclassified 2536
98 Ga0466691_070350 3300042593 Bacteria 4809
99 Ga0466695_342387 3300042595 Bacteria 3885
100 Ga0466696_017950 3300042596 Bacteria 25498
101 Ga0123357_10005847 3300009784 Bacteria 14836
102 Ga0123357_10069776 3300009784 Unclassified 4670
103 Ga0123354_10022012 3300010882 Bacteria 10050
104 Ga0123354_10040661 3300010882 Bacteria 7192
105 Ga0123354_10055737 3300010882 Unclassified 5910
106 Ga0068305_10003997 3300005083 Bacteria 66958
107 Ga0123357_10001884 3300009784 Bacteria 22787
108 Ga0466707_274951 3300042601 Bacteria 2226
109 Ga0466707_356695 3300042601 Bacteria 3851
110 Ga0466713_119049 3300042602 Bacteria 2469
111 Ga0466717_210866 3300042604 Bacteria 2965
112 Ga0466716_085791 3300042605 Bacteria 3446
113 Ga0466716_270187 3300042605 Bacteria 9107
114 Ga0466716_484769 3300042605 Bacteria 15133
115 Ga0466722_244942 3300042609 Bacteria 20047
116 Ga0466697_024428 3300042611 Bacteria 3048
117 Ga0466705_106886 3300042612 Bacteria 4198
118 Ga0466705_115473 3300042612 Bacteria 4476
119 Ga0466735_006680 3300042624 Bacteria 3211
120 Ga0466735_093353 3300042624 Bacteria 2155
121 Ga0466735_106535 3300042624 Bacteria 2616
122 Ga0466735_228417 3300042624 Bacteria 15817
123 Ga0466703_021431 3300042636 Bacteria 8419
124 Ga0466703_220552 3300042636 Bacteria 2341
125 Ga0466704_137932 3300042643 Bacteria 6006
126 Ga0466704_178658 3300042643 Bacteria 7761
127 Ga0466727_045746 3300042655 Unclassified 8654
128 Ga0466715_552033 3300042616 Bacteria 5377
129 Ga0466723_030686 3300042618 Bacteria 3059
130 Ga0466723_117096 3300042618 Bacteria 9786
131 Ga0466723_154223 3300042618 Bacteria 18006
132 Ga0466728_293860 3300042620 Bacteria 11643
133 Ga0466690_004052 3300042590 Unclassified 11857
134 Ga0466690_032500 3300042590 Bacteria 2187
135 Ga0466691_124183 3300042593 Bacteria 15574
136 Ga0466691_151559 3300042593 Bacteria 3286
137 Ga0466691_186282 3300042593 Bacteria 110439
138 Ga0466696_089421 3300042596 Bacteria 17272
139 Ga0123357_10006965 3300009784 Bacteria 13898
140 Ga0123354_10005918 3300010882 Bacteria 17982
141 Ga0123354_10013850 3300010882 Unclassified 12538
142 2227111367 2225789004 Bacteria 9434
143 IMNBL1DRAFT_c0006129 3300000062 Bacteria 6659
144 Ga0068305_10005550 3300005083 Unclassified 2562
145 Ga0123357_10000272 3300009784 Bacteria 49371
146 Ga0466706_141992 3300042599 Bacteria 60260
147 Ga0466706_253000 3300042599 Bacteria 8725
148 Ga0466707_129004 3300042601 Bacteria 9259
149 Ga0466707_140899 3300042601 Bacteria 27118
150 Ga0466707_385919 3300042601 Bacteria 1867
151 Ga0466713_051288 3300042602 Bacteria 230715
152 Ga0466719_140820 3300042606 Bacteria 11060
153 Ga0466719_487740 3300042606 Bacteria 2456
154 Ga0466722_105168 3300042609 Bacteria 17047
155 Ga0466733_145349 3300042659 Bacteria 8107
156 Ga0466729_264079 3300042621 Bacteria 3478
157 Ga0466735_048121 3300042624 Bacteria 25384
158 Ga0466735_148287 3300042624 Bacteria 2342
159 Ga0466735_193202 3300042624 Bacteria 4198
160 Ga0466704_100847 3300042643 Bacteria 5781
161 Ga0466704_174504 3300042643 Bacteria 9220
162 Ga0466704_203059 3300042643 Bacteria 11743
163 Ga0466704_207884 3300042643 Bacteria 21995
164 Ga0466704_583464 3300042643 Bacteria 34188
165 Ga0466709_105646 3300042648 Bacteria 1892
166 Ga0466709_164171 3300042648 Bacteria 70343
167 Ga0466711_061153 3300042615 Bacteria 45788
168 Ga0466715_086418 3300042616 Bacteria 17729
169 Ga0466715_146484 3300042616 Unclassified 41530
170 Ga0466715_209229 3300042616 Bacteria 24393
171 Ga0466723_017147 3300042618 Bacteria 21568
172 Ga0466728_013139 3300042620 Bacteria 55903
173 Ga0466728_027494 3300042620 Bacteria 69574
174 Ga0466690_041882 3300042590 Bacteria 6109
175 Ga0466690_063493 3300042590 Bacteria 16531
176 Ga0466690_065941 3300042590 Bacteria 16634
177 Ga0466690_271830 3300042590 Bacteria 11599
178 Ga0466690_296557 3300042590 Unclassified 6172
179 Ga0466692_195567 3300042591 Bacteria 33065
180 Ga0466696_036368 3300042596 Bacteria 10964
181 Ga0466696_052929 3300042596 Bacteria 10385
182 Ga0466696_132913 3300042596 Bacteria 52155
183 Ga0466696_151459 3300042596 Bacteria 4804
184 Ga0123355_10373324 3300009826 Bacteria 1866
185 Ga0123356_10012535 3300010049 Bacteria 8220
186 Ga0123356_10061835 3300010049 Bacteria 3497
187 Ga0123353_10030780 3300010167 Bacteria 8300
188 Ga0123354_10062656 3300010882 Unclassified 5474
189 IMNBL1DRAFT_c0001359 3300000062 Bacteria 18408
190 IMNBL1DRAFT_c0007102 3300000062 Bacteria 5958
191 Ga0068302_10264016 3300005071 Bacteria 2101
192 Ga0466706_215473 3300042599 Bacteria 16890
193 Ga0466707_126978 3300042601 Bacteria 67227
194 Ga0466713_129444 3300042602 Bacteria 20978
195 Ga0466705_157324 3300042612 Unclassified 3637
196 Ga0562377_0004 3300056842 Bacteria 3525959
197 Ga0466735_061680 3300042624 Bacteria 3452
198 Ga0466735_118057 3300042624 Bacteria 3195
199 Ga0466730_078343 3300042625 Bacteria 4298
200 Ga0466703_034943 3300042636 Unclassified 2418
201 Ga0466703_195650 3300042636 Unclassified 3315
202 Ga0466704_441697 3300042643 Bacteria 17399
203 Ga0466727_063618 3300042655 Bacteria 5190
204 Ga0466727_215359 3300042655 Bacteria 55489
205 Ga0466723_083403 3300042618 Bacteria 3153
206 Ga0466728_036708 3300042620 Bacteria 33443
207 Ga0466728_067334 3300042620 Bacteria 4295
208 Ga0466690_242490 3300042590 Bacteria 11568
209 Ga0466690_348991 3300042590 Bacteria 4692
210 Ga0466691_218986 3300042593 Bacteria 13370
211 Ga0466696_271249 3300042596 Bacteria 6952
212 Ga0466696_490203 3300042596 Bacteria 7133
213 2227521851 2225789004 Bacteria 17179
214 IMNBL1DRAFT_c0000374 3300000062 Bacteria 38245
215 IMNBL1DRAFT_c0001114 3300000062 Bacteria 20562
216 IMNBL1DRAFT_c0005397 3300000062 Bacteria 7322
217 JGI24702J35022_10001809 3300002462 Bacteria 13166
218 JGI24699J35502_11133751 3300002509 Bacteria 14779
219 JGI24699J35502_11133950 3300002509 Bacteria 20831
220 Ga0068302_10029469 3300005071 Bacteria 3135
221 Ga0466701_035983 3300042598 Bacteria 36269
222 Ga0466707_015169 3300042601 Bacteria 9821
223 Ga0466707_035231 3300042601 Bacteria 2815
224 Ga0466707_077378 3300042601 Bacteria 2499
225 Ga0466707_142595 3300042601 Bacteria 4516
226 Ga0466713_016116 3300042602 Bacteria 46967
227 Ga0466697_140634 3300042611 Bacteria 34617
228 Ga0466729_253159 3300042621 Bacteria 7380
229 Ga0466735_000451 3300042624 Bacteria 15028
230 Ga0466735_016838 3300042624 Bacteria 28411
231 Ga0466735_110659 3300042624 Bacteria 2242
232 Ga0466730_009794 3300042625 Bacteria 3747
233 Ga0466703_323748 3300042636 Bacteria 3041
234 Ga0466709_117199 3300042648 Bacteria 4277
235 Ga0466709_207631 3300042648 Bacteria 22484
236 Ga0466708_115925 3300042652 Bacteria 13608
237 Ga0466727_163583 3300042655 Bacteria 22200
238 Ga0466711_255833 3300042615 Bacteria 3201
239 Ga0466711_269620 3300042615 Bacteria 10757
240 Ga0466715_014665 3300042616 Bacteria 23433
241 Ga0466715_217399 3300042616 Bacteria 37947
242 Ga0466715_264472 3300042616 Bacteria 19552
243 Ga0466690_066438 3300042590 Bacteria 12156
244 Ga0466690_116172 3300042590 Bacteria 3224
245 Ga0466690_185946 3300042590 Bacteria 26397
246 Ga0466696_058621 3300042596 Bacteria 6857
247 Ga0123353_10095680 3300010167 Bacteria 4785
248 Ga0123354_10000609 3300010882 Bacteria 37298
249 Ga0123354_10020667 3300010882 Bacteria 10359
250 IMNBL1DRAFT_c0001642 3300000062 Bacteria 16565
251 JGI24699J35502_11133817 3300002509 Bacteria 16307
252 Ga0466706_025945 3300042599 Bacteria 100859
253 Ga0466713_017181 3300042602 Bacteria 54753
254 Ga0466713_100118 3300042602 Bacteria 50595
255 Ga0466713_103453 3300042602 Bacteria 53549
256 Ga0466719_528437 3300042606 Unclassified 3552
257 Ga0466722_024398 3300042609 Bacteria 3347
258 Ga0466722_195717 3300042609 Bacteria 5788

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00682 HMGL-like HMGL-like 175 280 0.89
PF02436 PYC_OADA Conserved carboxylase domain 388 516 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00682 GO:0003824 catalytic activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.