Protein Family IF02038
Metagenome
Isolate
183
Members
79
Samples
165
Scaffolds
209.83
Avg Length
Representative Sequence
- ID
- 3300007767|Ga0105553_1005549|Ga0105553_10055494
- Length
- 252 aa
- Sequence
- LIAHLFAILMELITKGNYYISINPCYLLFINKKKPTFVKIYDMEEILKYFPDLTPEQIAQFEKLEEVYTDWNAKINVISRKDIHELYTKHVLHSLGIAKVMEFLPGASILDVGTGGGFPGVPLAILYPETNFYLIDIIAKKIRVVNEVVNALGLKNVKAEQKRAETINEKFDFIVSRAVTNMPDFVEWIRHKTKKENIHEFENGILYLKGGDLTEELKDFPKAVQFDLANIFSDEFFETKKVVYLPLKYKG*
Sample Types
Isolate
9.8%
Metagenome
90.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.3%
Kalotermitidae
18.2%
Blattidae
11.7%
Unclassified
9.1%
Formicidae
7.8%
Drosophilidae
7.8%
Termopsidae
5.2%
Rhinotermitidae
3.9%
Passalidae
2.6%
Daphniidae
1.3%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Nephropidae
1.3%
Cambaridae
1.3%
Taxonomy
Archaea
1
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 3 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 4 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 18 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 40 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 41 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 42 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 52 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 53 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 57 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 58 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 59 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 60 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 64 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 65 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 66 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 67 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 68 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 69 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 76 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 77 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 78 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 79 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_113384 | 3300042593 | Bacteria | 3580 |
| 2 | Ga0466691_199900 | 3300042593 | Bacteria | 20837 |
| 3 | Ga0466696_117864 | 3300042596 | Bacteria | 5918 |
| 4 | Ga0466696_124171 | 3300042596 | Bacteria | 8996 |
| 5 | Ga0123353_10000136 | 3300010167 | Bacteria | 89026 |
| 6 | Ga0466707_014229 | 3300042601 | Bacteria | 20609 |
| 7 | Ga0466707_111724 | 3300042601 | Bacteria | 1606 |
| 8 | Ga0466713_043123 | 3300042602 | Bacteria | 81226 |
| 9 | Ga0466719_395744 | 3300042606 | Bacteria | 1673 |
| 10 | Ga0466722_191013 | 3300042609 | Bacteria | 3312 |
| 11 | Ga0466698_228406 | 3300042610 | Bacteria | 2517 |
| 12 | Ga0104019_1030524 | 3300007150 | Bacteria | 6342 |
| 13 | Ga0105553_1001258 | 3300007767 | Unclassified | 3179 |
| 14 | Ga0105553_1096301 | 3300007767 | Unclassified | 4059 |
| 15 | Ga0466697_164988 | 3300042611 | Bacteria | 1372 |
| 16 | Ga0466697_175217 | 3300042611 | Bacteria | 24944 |
| 17 | Ga0466731_214305 | 3300042622 | Bacteria | 3865 |
| 18 | Ga0466703_123817 | 3300042636 | Bacteria | 10381 |
| 19 | Ga0466704_551282 | 3300042643 | Bacteria | 3028 |
| 20 | Ga0466704_573103 | 3300042643 | Bacteria | 6609 |
| 21 | Ga0466709_269068 | 3300042648 | Bacteria | 7495 |
| 22 | Ga0466715_007956 | 3300042616 | Bacteria | 40920 |
| 23 | Ga0466715_263403 | 3300042616 | Bacteria | 1025 |
| 24 | Ga0466715_619005 | 3300042616 | Bacteria | 49282 |
| 25 | Ga0466723_006640 | 3300042618 | Bacteria | 26078 |
| 26 | Ga0466733_210904 | 3300042659 | Bacteria | 42489 |
| 27 | Ga0466656_221286 | 3300042550 | Bacteria | 8667 |
| 28 | Ga0466692_167706 | 3300042591 | Bacteria | 2576 |
| 29 | Ga0466696_036064 | 3300042596 | Bacteria | 108856 |
| 30 | Ga0466696_204542 | 3300042596 | Bacteria | 4996 |
| 31 | Ga0123356_10514129 | 3300010049 | Bacteria | 1355 |
| 32 | Ga0123353_11794465 | 3300010167 | Bacteria | 763 |
| 33 | Ga0466713_073116 | 3300042602 | Bacteria | 2194 |
| 34 | Ga0466713_149376 | 3300042602 | Bacteria | 31653 |
| 35 | 2227669912 | 2225789004 | Bacteria | 1903 |
| 36 | IMNBL1DRAFT_c0063804 | 3300000062 | Bacteria | 1094 |
| 37 | JGI24698J34947_10135727 | 3300002449 | Bacteria | 1044 |
| 38 | JGI24702J35022_10008957 | 3300002462 | Bacteria | 5640 |
| 39 | Ga0068305_10003997 | 3300005083 | Bacteria | 66958 |
| 40 | Ga0104045_1023200 | 3300007085 | Bacteria | 2330 |
| 41 | Ga0102734_1000063 | 3300007129 | Bacteria | 59508 |
| 42 | Ga0466735_144926 | 3300042624 | Bacteria | 2206 |
| 43 | Ga0466703_277710 | 3300042636 | Bacteria | 8547 |
| 44 | Ga0466715_190114 | 3300042616 | Bacteria | 4304 |
| 45 | Ga0466715_208000 | 3300042616 | Bacteria | 5910 |
| 46 | Ga0466728_301000 | 3300042620 | Bacteria | 15979 |
| 47 | Ga0466733_044409 | 3300042659 | Archaea | 1019 |
| 48 | Ga0466733_078139 | 3300042659 | Bacteria | 1146 |
| 49 | Ga0466696_236321 | 3300042596 | Bacteria | 9172 |
| 50 | Ga0466701_020661 | 3300042598 | Bacteria | 53461 |
| 51 | Ga0466701_036999 | 3300042598 | Bacteria | 203039 |
| 52 | Ga0466701_060216 | 3300042598 | Bacteria | 4084 |
| 53 | Ga0466707_371169 | 3300042601 | Bacteria | 2360 |
| 54 | Ga0466713_035886 | 3300042602 | Bacteria | 236629 |
| 55 | Ga0466719_043632 | 3300042606 | Bacteria | 9611 |
| 56 | Ga0466719_311507 | 3300042606 | Bacteria | 11845 |
| 57 | JGI24699J35502_11134130 | 3300002509 | Bacteria | 34690 |
| 58 | Ga0072941_1274611 | 3300005201 | Bacteria | 2713 |
| 59 | Ga0123357_10000477 | 3300009784 | Bacteria | 39043 |
| 60 | Ga0466705_100268 | 3300042612 | Bacteria | 14782 |
| 61 | Ga0466711_114294 | 3300042615 | Bacteria | 16823 |
| 62 | Ga0466723_180016 | 3300042618 | Bacteria | 15184 |
| 63 | Ga0466726_207929 | 3300042619 | Bacteria | 8181 |
| 64 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 65 | Ga0466657_109403 | 3300042582 | Bacteria | 3175 |
| 66 | Ga0466693_438675 | 3300042592 | Bacteria | 1659 |
| 67 | Ga0466691_113066 | 3300042593 | Bacteria | 9717 |
| 68 | Ga0466707_280256 | 3300042601 | Bacteria | 8588 |
| 69 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 70 | Ga0466716_119658 | 3300042605 | Bacteria | 2328 |
| 71 | Ga0466716_363242 | 3300042605 | Bacteria | 12973 |
| 72 | Ga0466722_157799 | 3300042609 | Bacteria | 1451 |
| 73 | Ga0068305_10042886 | 3300005083 | Bacteria | 6888 |
| 74 | Ga0102739_1000015 | 3300007095 | Bacteria | 59348 |
| 75 | Ga0102737_1000410 | 3300007142 | Bacteria | 14311 |
| 76 | Ga0466704_293340 | 3300042643 | Bacteria | 21702 |
| 77 | Ga0466727_113759 | 3300042655 | Bacteria | 15347 |
| 78 | Ga0466710_169195 | 3300042613 | Bacteria | 14656 |
| 79 | Ga0466715_406328 | 3300042616 | Bacteria | 39935 |
| 80 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 81 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 82 | Ga0123356_10845580 | 3300010049 | Bacteria | 1086 |
| 83 | Ga0466701_046420 | 3300042598 | Bacteria | 20498 |
| 84 | Ga0466706_056695 | 3300042599 | Bacteria | 15388 |
| 85 | Ga0466707_205352 | 3300042601 | Bacteria | 12166 |
| 86 | Ga0466713_115337 | 3300042602 | Bacteria | 64305 |
| 87 | Ga0466714_001434 | 3300042603 | Bacteria | 1213 |
| 88 | Ga0466717_021672 | 3300042604 | Bacteria | 1102 |
| 89 | 2227122483 | 2225789004 | Bacteria | 9127 |
| 90 | 2227647707 | 2225789004 | Bacteria | 2020 |
| 91 | JGI24705J35276_12237316 | 3300002504 | Bacteria | 10651 |
| 92 | Ga0103265_1000368 | 3300007068 | Unclassified | 7571 |
| 93 | Ga0466703_338718 | 3300042636 | Bacteria | 2160 |
| 94 | Ga0466703_414575 | 3300042636 | Bacteria | 31524 |
| 95 | Ga0466704_036177 | 3300042643 | Bacteria | 5279 |
| 96 | Ga0466704_063074 | 3300042643 | Bacteria | 10856 |
| 97 | Ga0466709_156301 | 3300042648 | Bacteria | 1857 |
| 98 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 99 | Ga0466724_65955 | 3300042649 | Bacteria | 2951 |
| 100 | Ga0466708_057045 | 3300042652 | Bacteria | 16815 |
| 101 | Ga0466727_123703 | 3300042655 | Bacteria | 13736 |
| 102 | Ga0466727_192779 | 3300042655 | Bacteria | 40853 |
| 103 | Ga0466711_389983 | 3300042615 | Bacteria | 28531 |
| 104 | Ga0466711_471547 | 3300042615 | Bacteria | 15822 |
| 105 | Ga0466726_182135 | 3300042619 | Bacteria | 2550 |
| 106 | Ga0466733_064172 | 3300042659 | Bacteria | 8043 |
| 107 | Ga0466733_154408 | 3300042659 | Bacteria | 1208 |
| 108 | Ga0466690_204641 | 3300042590 | Bacteria | 6323 |
| 109 | Ga0466694_164810 | 3300042594 | Bacteria | 1037 |
| 110 | Ga0466696_256065 | 3300042596 | Bacteria | 9502 |
| 111 | Ga0466696_345561 | 3300042596 | Bacteria | 8211 |
| 112 | Ga0123353_10000035 | 3300010167 | Bacteria | 147488 |
| 113 | Ga0466707_084833 | 3300042601 | Bacteria | 2227 |
| 114 | Ga0466707_405332 | 3300042601 | Bacteria | 8121 |
| 115 | Ga0466713_024194 | 3300042602 | Bacteria | 6215 |
| 116 | Ga0466719_454420 | 3300042606 | Bacteria | 2700 |
| 117 | IMNBL1DRAFT_c0003022 | 3300000062 | Bacteria | 11133 |
| 118 | CVPL010W_10000055 | 3300002931 | Bacteria | 71523 |
| 119 | Ga0068302_10150637 | 3300005071 | Bacteria | 1003 |
| 120 | Ga0074308_1114280 | 3300005307 | Bacteria | 1936 |
| 121 | Ga0104050_1207330 | 3300007153 | Bacteria | 1130 |
| 122 | Ga0103268_1000080 | 3300007192 | Bacteria | 31127 |
| 123 | Ga0105553_1005549 | 3300007767 | Bacteria | 5315 |
| 124 | Ga0466705_261705 | 3300042612 | Bacteria | 1434 |
| 125 | Ga0466705_297106 | 3300042612 | Bacteria | 9562 |
| 126 | Ga0466729_241579 | 3300042621 | Bacteria | 1998 |
| 127 | Ga0466735_098131 | 3300042624 | Bacteria | 1135 |
| 128 | Ga0466703_071903 | 3300042636 | Bacteria | 7598 |
| 129 | Ga0466703_231350 | 3300042636 | Bacteria | 2246 |
| 130 | Ga0466708_371014 | 3300042652 | Bacteria | 33751 |
| 131 | Ga0466727_318099 | 3300042655 | Bacteria | 12384 |
| 132 | Ga0466715_279259 | 3300042616 | Bacteria | 15035 |
| 133 | Ga0466723_042738 | 3300042618 | Bacteria | 46355 |
| 134 | Ga0466733_015565 | 3300042659 | Bacteria | 17314 |
| 135 | Ga0466690_104588 | 3300042590 | Bacteria | 10613 |
| 136 | Ga0466690_122525 | 3300042590 | Bacteria | 3807 |
| 137 | Ga0466691_081714 | 3300042593 | Bacteria | 10210 |
| 138 | Ga0466696_051573 | 3300042596 | Bacteria | 10685 |
| 139 | Ga0466696_057705 | 3300042596 | Bacteria | 4885 |
| 140 | Ga0123356_10068737 | 3300010049 | Bacteria | 3320 |
| 141 | Ga0466706_004061 | 3300042599 | Bacteria | 37101 |
| 142 | Ga0466707_133127 | 3300042601 | Bacteria | 4418 |
| 143 | Ga0466719_263239 | 3300042606 | Bacteria | 18951 |
| 144 | Ga0068302_10144474 | 3300005071 | Bacteria | 5624 |
| 145 | Ga0068305_10166380 | 3300005083 | Bacteria | 9289 |
| 146 | Ga0068305_10310418 | 3300005083 | Bacteria | 7027 |
| 147 | Ga0104050_1004742 | 3300007153 | Bacteria | 3453 |
| 148 | Ga0466704_479213 | 3300042643 | Bacteria | 10932 |
| 149 | Ga0466704_534735 | 3300042643 | Bacteria | 7273 |
| 150 | Ga0466715_573942 | 3300042616 | Bacteria | 7653 |
| 151 | Ga0466723_300061 | 3300042618 | Bacteria | 2387 |
| 152 | Ga0466728_013139 | 3300042620 | Bacteria | 55903 |
| 153 | Ga0466728_023032 | 3300042620 | Bacteria | 36227 |
| 154 | Ga0466733_065146 | 3300042659 | Bacteria | 3337 |
| 155 | Ga0466690_132253 | 3300042590 | Bacteria | 7282 |
| 156 | Ga0466692_016465 | 3300042591 | Bacteria | 61232 |
| 157 | Ga0123353_10561024 | 3300010167 | Bacteria | 1644 |
| 158 | Ga0466716_217304 | 3300042605 | Bacteria | 5857 |
| 159 | Ga0104048_1028572 | 3300007143 | Unclassified | 3512 |
| 160 | Ga0105553_1106725 | 3300007767 | Unclassified | 3166 |
| 161 | Ga0466710_009732 | 3300042613 | Unclassified | 4706 |
| 162 | Ga0466715_094373 | 3300042616 | Bacteria | 10890 |
| 163 | Ga0466718_160318 | 3300042617 | Bacteria | 2960 |
| 164 | Ga0466726_237889 | 3300042619 | Bacteria | 4827 |
| 165 | Ga0466728_270400 | 3300042620 | Bacteria | 35265 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.