Protein Family IF01847

Metagenome Isolate
263 Members
187 Samples
125 Scaffolds
384.48 Avg Length

🧬 Representative Sequence

ID
3300007188|Ga0103264_1000208|Ga0103264_100020853
Length
412 aa
Sequence
MDFELNDEQRAFADTARQFAMQAMAPHASQWDAEGIFPIDVIRAAGELGFCGLYANPDHGGLGLPRLDATLVFEALAEVCPSTTAYLTIHNMVNWMITTFARTDVAAQWGPRLSSGAQLGSYCLTEPGAGSDAASLITSARRDGDDYVINGTKAFISGAGATDVLVLMARTGGYGRKEEKMGWNSQPTRTITFEDVRIPAVNLLGQEGEGFRIAMKGLDGGRINIATCSVGAAQGALQAAHAHLQERKQFGKQLADFQALQFRLAEMTTQLVAARHMVRLAAVKLDAAHPDATTYCAMAKMFATDAGFRVCNDALQLHGGYGYIREYPLERWLRDTRVHQILEGTNEIMRLIISRRVLSAGDSALKRVTTRRSPQVTRTDTTSCLHRSEHAPFGFAHGREPAKSGLPGHGL*

📊 Sample Types

Isolate 52.5%
Metagenome 47.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.9%
Elmidae 16.5%
Formicidae 8.2%
Culicidae 8.2%
Termitidae 8.2%
Armadillidiidae 5.3%
Curculionidae 2.9%
Drosophilidae 2.9%
Talitridae 1.8%
Palinuridae 1.8%
Kalotermitidae 1.8%
Hydrophilidae 1.2%
Daphniidae 1.2%
Cambaridae 1.2%
Penaeidae 0.6%
Tenebrionidae 0.6%
Lysianassidae 0.6%
Majidae 0.6%
Trigoniulidae 0.6%
Nephropidae 0.6%
Artemiidae 0.6%
Apidae 0.6%
Crambidae 0.6%
Kiwaidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 231
Eukaryota 0
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864791955 Aeromonas veronii S00030 Isolate Elmidae
2 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
3 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
4 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
5 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
6 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
7 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
8 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
9 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
10 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
11 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
12 2585428048 Colwellia sp. NBT2012 Isolate
13 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
14 8022096067 Vibrio sp. SALL6 Isolate Unclassified
15 8051461712 Vibrio vulnificus Vv002 Isolate
16 8060845732 Vibrio vulnificus Vv006 Isolate
17 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
18 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
19 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
20 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
21 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
22 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
23 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
24 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
25 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
26 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
27 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
28 2603880170 Burkholderiales A2 Isolate Unclassified
29 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
30 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
31 2998907766 Penaeicola halotolerans LMIT005 Isolate
32 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
33 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
34 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
35 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
36 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
37 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
38 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
39 2864768727 Aeromonas veronii S00020 Isolate Elmidae
40 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
41 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
42 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
43 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
44 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
45 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
46 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
47 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
48 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
49 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
50 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
51 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
54 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
55 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
56 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
57 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
58 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
59 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
60 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
61 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
62 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
63 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
64 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
65 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
66 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
67 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
68 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
69 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
70 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
71 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
72 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
73 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
74 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
75 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
76 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
77 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
78 2585427605 Colwellia sp. MT2012 Isolate
79 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
80 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
81 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
82 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
83 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
84 2791355473 Vibrio barjaei 3062 Isolate Unclassified
85 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
86 8051534459 Vibrio vulnificus Vv004 Isolate
87 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
88 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
89 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
90 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
91 3006242587 Vibrio sp. RE86 Isolate Unclassified
92 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
93 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
94 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
95 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
96 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
97 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
98 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
99 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
100 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
101 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
102 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
103 2904728850 Flavobacterium sp. xlx-214 Isolate
104 2908136803 Vibrio owensii 1700302 Isolate Unclassified
105 2511231129 Vibrio sp. EJY3 Isolate Unclassified
106 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
107 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
108 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
109 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
110 640963010 Vibrio harveyi HY01 Isolate Unclassified
111 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
112 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
113 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
114 8100455565 Delftia sp. S67 Isolate Curculionidae
115 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
116 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
117 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
118 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
119 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
120 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
121 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
122 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
123 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
124 2868169047 Comamonas aquatica S00077 Isolate Elmidae
125 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
126 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
127 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
128 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
129 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
130 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
131 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
132 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
133 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
134 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
135 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
136 8100461708 Delftia sp. S65 Isolate Curculionidae
137 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
138 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
139 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
140 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
141 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
142 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
143 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
144 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
145 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
146 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
147 2850895757 Vibrio campbellii 170502 Isolate Unclassified
148 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
149 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
150 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
151 2864937364 Acidovorax soli S00198 Isolate Elmidae
152 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
153 2872471378 Vibrio owensii V180403 Isolate Unclassified
154 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
155 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
156 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
157 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
158 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
159 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
160 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
161 8022087107 Vibrio sp. OULL4 Isolate Unclassified
162 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
163 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
164 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
165 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
166 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
167 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
168 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
169 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
170 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
171 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
172 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
173 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
174 2912570088 Vibrio parahaemolyticus CHN25 Isolate
175 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
176 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
177 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
178 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
179 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
180 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
181 8051551332 Vibrio vulnificus Vv003 Isolate
182 8100449422 Delftia sp. S66 Isolate Curculionidae
183 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
184 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
185 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
186 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
187 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_048593 3300042598 Bacteria 51470
2 Ga0160465_101182 3300012803 Unclassified 8162
3 Ga0160466_102669 3300012809 Unclassified 3349
4 JGI24705J35276_12236796 3300002504 Bacteria 8945
5 CVPL005L_10005246 3300002938 Unclassified 19669
6 Ga0102734_1000097 3300007129 Bacteria 28598
7 Ga0103260_1000105 3300007139 Bacteria 21775
8 Ga0102737_1002111 3300007142 Bacteria 5084
9 Ga0102737_1006670 3300007142 Unclassified 2173
10 Ga0104048_1023242 3300007143 Unclassified 1729
11 Ga0104050_1026403 3300007153 Bacteria 4551
12 Ga0103264_1000132 3300007188 Bacteria 42832
13 Ga0103267_1000161 3300007190 Bacteria 45217
14 Ga0466730_079418 3300042625 Bacteria 679131
15 Ga0466724_54120 3300042649 Bacteria 266943
16 Ga0466725_245618 3300042654 Bacteria 1624
17 Ga0160467_103411 3300012829 Unclassified 2703
18 Ga0160472_104629 3300012839 Unclassified 2371
19 Ga0160443_100163 3300012848 Bacteria 93816
20 Ga0160430_100051 3300012852 Bacteria 124271
21 Ga0160448_100071 3300012854 Bacteria 63703
22 Ga0160435_1000245 3300012857 Bacteria 24971
23 Ga0466711_430743 3300042615 Bacteria 12659
24 Ga0466701_045669 3300042598 Bacteria 85216
25 CVPL005W_1000408 3300002934 Unclassified 17744
26 Ga0074308_1018184 3300005307 Unclassified 5774
27 Ga0104045_1019427 3300007085 Unclassified 4267
28 Ga0102737_1000167 3300007142 Bacteria 21930
29 Ga0466734_030513 3300042623 Bacteria 30324
30 Ga0466725_332846 3300042654 Bacteria 33341
31 Ga0160468_101149 3300012819 Unclassified 7358
32 Ga0160434_100091 3300012850 Bacteria 55948
33 Ga0160435_1005668 3300012857 Unclassified 2807
34 Ga0466656_316316 3300042550 Bacteria 2299
35 Ga0466701_050125 3300042598 Bacteria 85937
36 CVPL010W_10004352 3300002931 Bacteria 15885
37 Ga0103261_1000226 3300007083 Bacteria 9406
38 Ga0104050_1000671 3300007153 Bacteria 4130
39 Ga0103264_1000007 3300007188 Bacteria 144836
40 Ga0466708_424648 3300042652 Bacteria 7211
41 Ga0466725_230846 3300042654 Bacteria 3004
42 Ga0160433_100154 3300012846 Bacteria 58953
43 Ga0160443_100154 3300012848 Bacteria 98725
44 Ga0466701_019111 3300042598 Bacteria 65197
45 Ga0123354_10038867 3300010882 Bacteria 7383
46 DPOL_contig02311 2035918003 Unclassified 5346
47 SPBB_contig03388 2044078006 Unclassified 4664
48 CVPL005W_1000257 3300002934 Bacteria 23073
49 Ga0102735_1000182 3300007080 Bacteria 19417
50 Ga0104045_1004264 3300007085 Unclassified 5508
51 Ga0104048_1169394 3300007143 Bacteria 2116
52 Ga0104050_1001241 3300007153 Unclassified 11226
53 Ga0103267_1018161 3300007190 Unclassified 4112
54 Ga0466730_036904 3300042625 Unclassified 3889
55 Ga0160470_103196 3300012813 Bacteria 2717
56 Ga0160469_100160 3300012824 Bacteria 71074
57 Ga0160441_105015 3300012825 Unclassified 2006
58 Ga0160431_100056 3300012828 Bacteria 97724
59 Ga0160445_100066 3300012847 Bacteria 123455
60 Ga0466693_061076 3300042592 Bacteria 8322
61 Ga0466701_082567 3300042598 Bacteria 29061
62 CVPL005W_1000164 3300002934 Bacteria 28912
63 Ga0072941_1322872 3300005201 Bacteria 2081
64 Ga0102739_1000234 3300007095 Bacteria 13745
65 Ga0102734_1002060 3300007129 Unclassified 4846
66 Ga0102737_1000993 3300007142 Unclassified 8412
67 Ga0104048_1003060 3300007143 Bacteria 3914
68 Ga0104019_1004109 3300007150 Bacteria 10061
69 Ga0104050_1200471 3300007153 Bacteria 2299
70 Ga0103264_1000355 3300007188 Bacteria 41601
71 Ga0103267_1000045 3300007190 Bacteria 74090
72 Ga0103268_1000260 3300007192 Bacteria 17388
73 Ga0466730_024181 3300042625 Bacteria 38679
74 Ga0466724_46819 3300042649 Bacteria 306737
75 Ga0466708_151324 3300042652 Bacteria 3234
76 Ga0466657_152672 3300042582 Unclassified 1538
77 Ga0466701_010924 3300042598 Bacteria 123388
78 Ga0466701_018829 3300042598 Bacteria 4956
79 Ga0466701_026953 3300042598 Unclassified 4786
80 Ga0123357_10133076 3300009784 Bacteria 3087
81 Ga0160465_100057 3300012803 Bacteria 126446
82 Meta3P_1003308 3300002464 Unclassified 19770
83 CVPL005W_1000474 3300002934 Bacteria 29568
84 Ga0102740_1005947 3300007140 Unclassified 2693
85 Ga0103264_1000862 3300007188 Bacteria 28172
86 Ga0103267_1009203 3300007190 Bacteria 3144
87 Ga0466730_096842 3300042625 Bacteria 56272
88 Ga0466724_52883 3300042649 Bacteria 459297
89 Ga0160458_100879 3300012832 Bacteria 8279
90 Ga0160444_100156 3300012841 Bacteria 68274
91 Ga0160447_101490 3300012849 Bacteria 9074
92 Ga0160447_106423 3300012849 Bacteria 3110
93 Ga0160436_1000238 3300012861 Bacteria 26237
94 Ga0466701_002615 3300042598 Bacteria 9375
95 Ga0466701_006539 3300042598 Bacteria 166094
96 Ga0466710_348049 3300042613 Bacteria 1430
97 Ga0466701_016134 3300042598 Bacteria 4835
98 Ga0466701_049405 3300042598 Bacteria 162418
99 Ga0466721_195240 3300042608 Bacteria 4526
100 Ga0160471_100689 3300012812 Unclassified 8355
101 CVPL010W_10002900 3300002931 Unclassified 19962
102 Ga0102736_1004668 3300007052 Bacteria 1810
103 Ga0103264_1000208 3300007188 Bacteria 52687
104 Ga0466705_300706 3300042612 Bacteria 16398
105 Ga0466730_022941 3300042625 Bacteria 238769
106 Ga0466730_055459 3300042625 Unclassified 21836
107 Ga0160469_100115 3300012824 Unclassified 116736
108 Ga0160431_100295 3300012828 Bacteria 28623
109 Ga0160457_1000092 3300012858 Bacteria 118084
110 Ga0160436_1000047 3300012861 Bacteria 66204
111 Ga0160436_1000355 3300012861 Unclassified 19468
112 Ga0157631_138360 3300013007 Bacteria 3325
113 Ga0466656_189955 3300042550 Bacteria 3174
114 Ga0466701_022073 3300042598 Bacteria 54125
115 Ga0466717_072754 3300042604 Unclassified 6275
116 Ga0160464_100004 3300012805 Bacteria 404522
117 Ga0160466_100037 3300012809 Bacteria 197425
118 CVPL005L_10001082 3300002938 Bacteria 37702
119 Ga0102740_1009577 3300007140 Unclassified 1558
120 Ga0103264_1000153 3300007188 Bacteria 44108
121 Ga0466724_58610 3300042649 Bacteria 376410
122 Ga0466724_59820 3300042649 Bacteria 124441
123 Ga0466724_69524 3300042649 Bacteria 891007
124 Ga0160455_100406 3300012837 Bacteria 23909
125 Ga0160430_108847 3300012852 Bacteria 1866

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 208 358 0.99
PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 6 116 0.97
PF08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain 225 345 0.91
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 122 172 0.89
PF22924 ACOX_C_alpha1 Acyl-CoA oxidase, C-alpha1 domain 252 356 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00441 GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.