Protein Family IF01838

Metagenome Metatranscriptome Isolate
480 Members
290 Samples
286 Scaffolds
92.93 Avg Length

🧬 Representative Sequence

ID
3300007153|Ga0104050_1212085|Ga0104050_12120853
Length
103 aa
Sequence
LLLRQWQTHGPRSLKKGPFVDDHLLRKVVKQNEAKSQNVIKTWSRRSMIVPAMLGHTIAVHDGRKHIPVFVTETMVGHKLGEFAPTRTFRGHVKDDKKGRRR*

πŸ“Š Sample Types

Isolate 40.4%
Metagenome 58.3%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 24.0%
Termitidae 15.1%
Formicidae 7.5%
Apidae 5.4%
Kalotermitidae 4.7%
Scarabaeidae 4.3%
Anthocoridae 3.6%
Culicidae 3.6%
Cambaridae 3.2%
Tenebrionidae 3.2%
Elmidae 2.9%
Drosophilidae 2.9%
Armadillidiidae 2.2%
Pyralidae 1.8%
Chrysomelidae 1.8%
Rhinotermitidae 1.4%
Noctuidae 1.1%
Dytiscidae 1.1%
Hydrophilidae 1.1%
Termopsidae 1.1%
Curculionidae 0.7%
Bombycidae 0.7%
Eresidae 0.4%
Pentatomidae 0.4%
Penaeidae 0.4%
Portunidae 0.4%
Cimicidae 0.4%
Nephropidae 0.4%
Ocypodidae 0.4%
Thomisidae 0.4%
Calliphoridae 0.4%
Pseudococcidae 0.4%
Hodotermitidae 0.4%
Passalidae 0.4%
Siricidae 0.4%
Euphausiidae 0.4%
Chironomidae 0.4%
Ixodidae 0.4%
Reduviidae 0.4%
Cerambycidae 0.4%
Kiwaidae 0.4%

🌳 Taxonomy

Archaea 1
Bacteria 427
Eukaryota 0
Viruses 0
Unclassified 52

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
2 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
3 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
4 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
5 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
6 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
7 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
8 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
9 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
10 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
11 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
12 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
13 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
14 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
15 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
16 2862784999 Streptomyces sp. M41 Isolate Unclassified
17 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
18 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
19 2864895409 Bacillus aerius S00152 Isolate Elmidae
20 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
21 2909412500 Yimella sp. cx-573 Isolate Cambaridae
22 2931430189 Tessaracoccus palaemonis J1M15 Isolate
23 8022725327 Bacillus sp. SN10 Isolate Eresidae
24 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
31 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
32 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
33 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
34 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
35 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
36 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
37 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
38 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
39 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
40 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
41 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
42 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
43 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
44 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
45 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
46 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
47 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
48 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
49 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
50 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
51 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
52 2912749649 Streptomyces sp. GS7 Isolate Termitidae
53 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
54 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
55 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
56 8062747827 Yimella sp. cx-51 Isolate Cambaridae
57 8082023105 Niallia sp. Man26 Isolate Penaeidae
58 2969145278 Bacillus cereus 29 Isolate Portunidae
59 2998828810 Enterobacteriaceae endosymbiont of Donacia simplex DsimSym Isolate Chrysomelidae
60 3006461590 Streptomyces sp. RB5 Isolate Termitidae
61 3006667155 Streptomyces sp. SID9727 Isolate
62 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
63 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
64 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
65 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
66 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
67 2505679068 Isoptericola variabilis 225 Isolate Unclassified
68 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
69 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
70 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
71 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
72 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
73 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
74 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
75 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
76 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
77 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
78 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
79 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
80 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
81 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
82 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
83 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
84 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
85 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
86 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
87 8062637095 Yimella sp. cx-51 Isolate Cambaridae
88 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
89 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
90 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
91 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
92 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
93 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
94 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
95 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
96 2978778678 Bacillus cereus 25 Isolate Ocypodidae
97 2998834864 Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym Isolate Chrysomelidae
98 3300005313 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut Metagenome Drosophilidae
99 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
100 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
101 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
102 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
103 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
104 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
105 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
106 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
107 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
108 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
109 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
110 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
111 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
112 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
113 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
114 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
115 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
116 2908241010 Streptomyces sp. HF10 Isolate Termitidae
117 2912817845 Streptomyces griseus SID164 Isolate
118 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
119 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
120 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
121 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
122 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
123 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
124 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
125 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
126 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
127 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
128 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
129 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
130 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
131 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
132 2998828354 Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym Isolate Chrysomelidae
133 3006468911 Streptomyces sp. RB17 Isolate Termitidae
134 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
135 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
136 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
137 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
138 2504756063 Isoptericola variabilis J5 Isolate Unclassified
139 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
140 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
141 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
142 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
143 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
144 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
145 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
146 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
147 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
148 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
149 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
150 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
151 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
152 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
153 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
154 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
155 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
156 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
157 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
158 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
159 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
160 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
161 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
162 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
163 650716018 Candidatus Tremblaya princeps PCIT Isolate Pseudococcidae
164 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
165 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
166 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
167 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
168 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
169 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
170 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
171 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
172 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
173 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
174 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
175 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
176 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
177 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
178 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
179 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
180 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
181 2537562000 Bacillus cereus HD73 Isolate Pyralidae
182 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
183 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
184 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
185 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
186 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
187 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
188 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
189 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
190 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
191 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
192 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
193 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
194 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
195 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
196 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
197 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
198 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
199 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
200 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
201 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
202 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
203 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
204 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
205 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
206 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
207 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
208 2998832509 Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym Isolate Chrysomelidae
209 3002678670 Agromyces sp. G127AT Isolate Unclassified
210 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
211 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
212 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
213 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
214 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
215 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
216 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
217 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
218 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
219 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
220 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
221 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
222 2820316744 Unclassified Firmicutes Nt197P3bin99 Isolate Unclassified
223 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
224 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
225 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
226 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
227 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
228 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
229 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
230 2896955351 Streptomyces sp. GF20 Isolate Termitidae
231 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
232 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
233 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
234 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
235 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
236 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
237 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
238 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
239 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
240 649989992 Pseudonocardia sp. P1 Isolate Formicidae
241 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
242 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
243 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
244 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
245 8073544309 Actinomadura sp. RB99 Isolate Termitidae
246 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
247 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
248 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
249 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
250 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
251 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
252 2547132081 Streptomyces sp. S4 Isolate Formicidae
253 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
254 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
255 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
256 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
257 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
258 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
259 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
260 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
261 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
262 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
263 2864801025 Bacillus aerius S00042 Isolate Elmidae
264 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
265 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
266 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
267 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
268 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
269 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
270 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
271 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
272 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
273 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
274 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
275 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
276 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
277 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
278 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
279 2986970932 Candidatus Fukatsuia symbiotica 5D Isolate Unclassified
280 2998979428 Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym Isolate Chrysomelidae
281 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
282 3300005320 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut Metagenome Drosophilidae
283 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
284 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
285 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
286 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
287 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
288 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
289 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
290 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160444_102085 3300012841 Bacteria 3192
2 Ga0160430_100932 3300012852 Unclassified 12770
3 Ga0160435_1028205 3300012857 Bacteria 911
4 Ga0160436_1000191 3300012861 Bacteria 30420
5 Ga0255809_1038726 3300022820 Bacteria 1228
6 Ga0415639_095019 3300038395 Bacteria 3384
7 Ga0466657_074188 3300042582 Bacteria 17452
8 Ga0466696_357816 3300042596 Bacteria 5533
9 Ga0466706_198118 3300042599 Bacteria 7169
10 Ga0466713_092829 3300042602 Unclassified 1119
11 Ga0466713_143014 3300042602 Unclassified 1023
12 Ga0466717_202545 3300042604 Unclassified 1329
13 Ga0466719_086513 3300042606 Bacteria 15067
14 Ga0562379_0022 3300056790 Bacteria 931623
15 Ga0562379_0100 3300056790 Bacteria 294662
16 JGI24705J35276_12148859 3300002504 Bacteria 1174
17 JGI24705J35276_12217339 3300002504 Unclassified 2088
18 JGI24705J35276_12237980 3300002504 Bacteria 14674
19 CVPL010L_1000082 3300002932 Bacteria 29431
20 Ga0072940_1147464 3300005200 Bacteria 753
21 Ga0104041_1112941 3300007106 Bacteria 1634
22 Ga0123357_10001723 3300009784 Bacteria 23593
23 Ga0123357_10521803 3300009784 Bacteria 970
24 Ga0123356_10423204 3300010049 Unclassified 1474
25 Ga0123356_11489444 3300010049 Bacteria 835
26 Ga0123353_10001965 3300010167 Bacteria 25350
27 Ga0123353_12541589 3300010167 Bacteria 608
28 Ga0123354_11082892 3300010882 Bacteria 510
29 Ga0466731_366030 3300042622 Unclassified 1317
30 Ga0466734_168885 3300042623 Bacteria 1325
31 Ga0466730_030052 3300042625 Bacteria 1063
32 Ga0466725_194892 3300042654 Bacteria 1674
33 Ga0466727_108937 3300042655 Bacteria 1391
34 Ga0466705_150947 3300042612 Bacteria 2035
35 Ga0466705_276363 3300042612 Bacteria 19722
36 Ga0466715_562604 3300042616 Bacteria 3932
37 Ga0160456_100878 3300012820 Bacteria 8059
38 Ga0160455_101026 3300012837 Bacteria 9976
39 Ga0160455_105580 3300012837 Bacteria 1357
40 Ga0160434_125687 3300012850 Unclassified 865
41 Ga0466692_152767 3300042591 Unclassified 1820
42 Ga0466692_181714 3300042591 Bacteria 1778
43 Ga0466691_018487 3300042593 Bacteria 80759
44 Ga0466694_258653 3300042594 Unclassified 2190
45 Ga0466700_162385 3300042600 Bacteria 12987
46 Ga0466707_003303 3300042601 Bacteria 1183
47 Ga0466713_024575 3300042602 Bacteria 38766
48 Ga0466717_244400 3300042604 Bacteria 1483
49 Ga0466722_216957 3300042609 Bacteria 6832
50 Ga0562375_0206 3300056856 Bacteria 165734
51 Ga0590775_01042 3300060896 Bacteria 3883
52 CwormDRAF_NODE_3131_len_1871_cov_227_625336 2035265002 Bacteria 1901
53 JGI24703J35330_11018770 3300002501 Bacteria 642
54 JGI24699J35502_11122228 3300002509 Unclassified 3414
55 Ga0074278_142794 3300005721 Bacteria 8443
56 Ga0123357_10992084 3300009784 Unclassified 524
57 Ga0123355_10136223 3300009826 Bacteria 3771
58 Ga0123355_10821954 3300009826 Bacteria 1030
59 Ga0123355_11689076 3300009826 Unclassified 604
60 Ga0123356_10026024 3300010049 Bacteria 5499
61 Ga0123356_10154107 3300010049 Unclassified 2286
62 Ga0123356_11748082 3300010049 Bacteria 772
63 Ga0123356_12464635 3300010049 Unclassified 651
64 Ga0123356_13851465 3300010049 Bacteria 518
65 Ga0466734_048236 3300042623 Bacteria 1683
66 Ga0466734_065425 3300042623 Unclassified 1819
67 Ga0466730_055821 3300042625 Bacteria 8238
68 Ga0466730_077789 3300042625 Bacteria 2447
69 Ga0466703_340076 3300042636 Bacteria 2362
70 Ga0466703_372472 3300042636 Archaea 7762
71 Ga0466727_119340 3300042655 Bacteria 6208
72 Ga0466705_206890 3300042612 Unclassified 1277
73 Ga0466705_311150 3300042612 Bacteria 166746
74 Ga0466657_090451 3300042582 Bacteria 1690
75 Ga0466692_079565 3300042591 Bacteria 1385
76 Ga0466691_126587 3300042593 Unclassified 2351
77 Ga0466706_025530 3300042599 Bacteria 5055
78 Ga0466706_228981 3300042599 Unclassified 2031
79 Ga0466716_539679 3300042605 Bacteria 1913
80 Ga0466719_173271 3300042606 Bacteria 1008
81 Ga0466697_030590 3300042611 Bacteria 1976
82 Ga0466733_150248 3300042659 Bacteria 8066
83 Ga0562379_0410 3300056790 Bacteria 93813
84 Ga0562379_0489 3300056790 Bacteria 79810
85 Ga0562377_0137 3300056842 Bacteria 212469
86 Ga0562375_3896 3300056856 Unclassified 12659
87 Ga0562374_2969 3300057007 Bacteria 11860
88 IMNBGM34_c019248 3300000036 Unclassified 854
89 AustNasuHG_c1039497 3300000089 Bacteria 1171
90 Ga0052191_100638 3300003097 Bacteria 1901
91 Ga0105524_101309 3300007733 Bacteria 18026
92 Ga0123355_10002085 3300009826 Bacteria 28219
93 Ga0123355_10003652 3300009826 Bacteria 22170
94 Ga0123356_10110004 3300010049 Bacteria 2660
95 Ga0123356_12491985 3300010049 Bacteria 647
96 Ga0123353_10654171 3300010167 Bacteria 1487
97 Ga0123353_12603164 3300010167 Unclassified 599
98 Ga0123354_10340563 3300010882 Unclassified 1352
99 Ga0123354_10476083 3300010882 Bacteria 991
100 Ga0123354_10853586 3300010882 Unclassified 604
101 Ga0123354_10931412 3300010882 Bacteria 566
102 Ga0466731_005499 3300042622 Bacteria 2596
103 Ga0466731_176442 3300042622 Bacteria 1769
104 Ga0466734_013378 3300042623 Bacteria 1396
105 Ga0466734_138845 3300042623 Bacteria 2628
106 Ga0466730_070672 3300042625 Unclassified 1742
107 Ga0466702_463679 3300042635 Bacteria 3046
108 Ga0466725_406302 3300042654 Unclassified 1877
109 Ga0466727_301924 3300042655 Bacteria 7055
110 Ga0466718_138336 3300042617 Bacteria 1885
111 Ga0466723_178188 3300042618 Bacteria 1854
112 Ga0466723_220679 3300042618 Bacteria 5167
113 Ga0160447_118283 3300012849 Unclassified 1197
114 Ga0160457_1037109 3300012858 Bacteria 662
115 Ga0157631_103502 3300013007 Bacteria 4449
116 Ga0223687_100094 3300021217 Bacteria 12922
117 Ga0466706_118984 3300042599 Bacteria 1057
118 Ga0466706_154978 3300042599 Bacteria 125008
119 Ga0466716_344665 3300042605 Bacteria 4778
120 Ga0466733_131946 3300042659 Bacteria 20509
121 Ga0104019_1029748 3300007150 Bacteria 1562
122 Ga0123357_10000801 3300009784 Bacteria 31843
123 Ga0123357_10129647 3300009784 Bacteria 3146
124 Ga0123357_10325022 3300009784 Bacteria 1513
125 Ga0123355_10192841 3300009826 Unclassified 2996
126 Ga0123355_10892810 3300009826 Unclassified 968
127 Ga0123356_10004286 3300010049 Bacteria 14755
128 Ga0123356_10025041 3300010049 Bacteria 5609
129 Ga0123356_10080711 3300010049 Bacteria 3076
130 Ga0123354_10002396 3300010882 Bacteria 24675
131 Ga0123354_10031618 3300010882 Bacteria 8300
132 Ga0123354_10606064 3300010882 Unclassified 800
133 Ga0123354_10799702 3300010882 Unclassified 636
134 Ga0160466_101685 3300012809 Bacteria 5385
135 Ga0466729_208868 3300042621 Bacteria 4517
136 Ga0466729_248897 3300042621 Unclassified 2454
137 Ga0466735_129467 3300042624 Bacteria 2323
138 Ga0466704_180303 3300042643 Unclassified 4498
139 Ga0466709_052786 3300042648 Bacteria 2017
140 Ga0466724_12518 3300042649 Bacteria 3451
141 Ga0466697_259946 3300042611 Bacteria 1006
142 Ga0466715_322665 3300042616 Bacteria 16211
143 Ga0160435_1015353 3300012857 Bacteria 1464
144 Ga0223682_1017386 3300021231 Unclassified 981
145 Ga0466693_153344 3300042592 Bacteria 1527
146 Ga0466706_099650 3300042599 Bacteria 1150
147 Ga0466707_086104 3300042601 Bacteria 138731
148 Ga0466707_287085 3300042601 Bacteria 1030
149 Ga0466707_302603 3300042601 Bacteria 62986
150 Ga0466713_036385 3300042602 Unclassified 2719
151 Ga0466720_192207 3300042607 Bacteria 1109
152 Ga0466733_010171 3300042659 Bacteria 4019
153 Ga0530661_000008 3300056564 Bacteria 327436
154 Ga0562377_0135 3300056842 Bacteria 217276
155 Ga0562376_2795 3300056857 Bacteria 19515
156 Ga0562376_3020 3300056857 Bacteria 18242
157 JGI24695J34938_10014000 3300002450 Bacteria 4183
158 JGI24705J35276_11847251 3300002504 Bacteria 713
159 JGI24699J35502_10723643 3300002509 Bacteria 789
160 Ga0072941_1015847 3300005201 Bacteria 35185
161 Ga0074317_1169576 3300005320 Bacteria 581
162 Ga0123357_10101253 3300009784 Bacteria 3713
163 Ga0123355_10006887 3300009826 Bacteria 16926
164 Ga0123355_10534016 3300009826 Unclassified 1427
165 Ga0123355_10902533 3300009826 Bacteria 960
166 Ga0123355_11984928 3300009826 Unclassified 540
167 Ga0123355_12088304 3300009826 Unclassified 522
168 Ga0123356_10846047 3300010049 Bacteria 1086
169 Ga0123353_11862112 3300010167 Bacteria 744
170 Ga0466729_283145 3300042621 Bacteria 1064
171 Ga0466734_155361 3300042623 Unclassified 1618
172 Ga0466730_002774 3300042625 Bacteria 2535
173 Ga0466724_28716 3300042649 Bacteria 223742
174 Ga0466708_305231 3300042652 Unclassified 1600
175 Ga0466725_086625 3300042654 Bacteria 5211
176 Ga0466710_345768 3300042613 Bacteria 1178
177 Ga0466726_207627 3300042619 Bacteria 1324
178 Ga0466728_416312 3300042620 Bacteria 6638
179 Ga0160468_104669 3300012819 Bacteria 1626
180 Ga0160446_111079 3300012835 Unclassified 1136
181 Ga0160472_117505 3300012839 Bacteria 738
182 Ga0160444_111275 3300012841 Bacteria 1078
183 Ga0160460_105136 3300012845 Bacteria 1913
184 Ga0223683_1019425 3300021245 Bacteria 806
185 Ga0415639_241421 3300038395 Unclassified 1515
186 Ga0466656_344090 3300042550 Bacteria 1262
187 Ga0466657_241321 3300042582 Bacteria 1814
188 Ga0466696_184466 3300042596 Bacteria 1138
189 Ga0466707_175608 3300042601 Bacteria 13441
190 Ga0466713_013445 3300042602 Bacteria 31659
191 Ga0466713_123340 3300042602 Bacteria 1498
192 Ga0466733_025245 3300042659 Bacteria 172347
193 Ga0562374_0013 3300057007 Bacteria 1517757
194 JGI24705J35276_12219906 3300002504 Bacteria 2233
195 Ga0104050_1212085 3300007153 Bacteria 911
196 Ga0123357_10167563 3300009784 Bacteria 2610
197 Ga0123355_11181028 3300009826 Bacteria 784
198 Ga0123353_10003840 3300010167 Bacteria 19170
199 Ga0123353_11162817 3300010167 Bacteria 1017
200 Ga0123353_11917199 3300010167 Bacteria 730
201 Ga0123354_10004680 3300010882 Bacteria 19492
202 Ga0123354_10035070 3300010882 Bacteria 7836
203 Ga0123354_10115333 3300010882 Bacteria 3512
204 Ga0123354_10189312 3300010882 Bacteria 2311
205 Ga0466734_134621 3300042623 Bacteria 3084
206 Ga0466735_002942 3300042624 Bacteria 1866
207 Ga0466735_228119 3300042624 Bacteria 1256
208 Ga0466730_007810 3300042625 Bacteria 11605
209 Ga0466730_044927 3300042625 Bacteria 3039
210 Ga0466703_243244 3300042636 Unclassified 2465
211 Ga0466703_416321 3300042636 Bacteria 11405
212 Ga0466704_582723 3300042643 Bacteria 43560
213 Ga0466724_64838 3300042649 Bacteria 17323
214 Ga0466725_219676 3300042654 Bacteria 1458
215 Ga0466710_311777 3300042613 Bacteria 6061
216 Ga0466711_384397 3300042615 Bacteria 4317
217 Ga0466729_156052 3300042621 Bacteria 12586
218 Ga0466729_158104 3300042621 Bacteria 83475
219 Ga0160432_100761 3300012818 Bacteria 15685
220 Ga0160459_109573 3300012831 Unclassified 1175
221 Ga0160433_107479 3300012846 Bacteria 1503
222 Ga0160434_100001 3300012850 Bacteria 617314
223 Ga0160434_134878 3300012850 Bacteria 690
224 Ga0223686_1013240 3300021244 Bacteria 1134
225 Ga0466693_110507 3300042592 Bacteria 60686
226 Ga0466693_353530 3300042592 Bacteria 63745
227 Ga0466694_257882 3300042594 Bacteria 3725
228 Ga0466696_453420 3300042596 Bacteria 1176
229 Ga0466707_221470 3300042601 Bacteria 71824
230 Ga0466713_101616 3300042602 Bacteria 503322
231 Ga0466722_035212 3300042609 Bacteria 19731
232 Ga0466697_055560 3300042611 Bacteria 2670
233 Ga0466733_013454 3300042659 Bacteria 3737
234 Ga0562379_0066 3300056790 Bacteria 440869
235 Ga0562376_0381 3300056857 Bacteria 84233
236 JGI24699J35502_10455235 3300002509 Bacteria 591
237 Ga0072941_1064399 3300005201 Bacteria 1334
238 Ga0104048_1137616 3300007143 Bacteria 578
239 Ga0123357_10000864 3300009784 Bacteria 30882
240 Ga0123357_10081341 3300009784 Unclassified 4258
241 Ga0123357_10899687 3300009784 Bacteria 572
242 Ga0123356_11698901 3300010049 Bacteria 783
243 Ga0123353_10839554 3300010167 Bacteria 1261
244 Ga0123354_10185721 3300010882 Bacteria 2353
245 Ga0466734_005313 3300042623 Bacteria 1457
246 Ga0466734_063643 3300042623 Bacteria 3376
247 Ga0466730_028064 3300042625 Bacteria 1269
248 Ga0466730_038413 3300042625 Unclassified 1565
249 Ga0466703_115413 3300042636 Bacteria 35262
250 Ga0466703_429535 3300042636 Bacteria 36032
251 Ga0466704_604583 3300042643 Bacteria 1900
252 Ga0466704_611769 3300042643 Bacteria 3580
253 Ga0466724_66581 3300042649 Bacteria 665985
254 Ga0466727_061146 3300042655 Bacteria 1712
255 Ga0466697_118605 3300042611 Bacteria 1071
256 Ga0466705_129627 3300042612 Bacteria 1291
257 Ga0466712_080838 3300042614 Bacteria 1798
258 Ga0466711_253939 3300042615 Bacteria 18586
259 Ga0466726_267387 3300042619 Unclassified 2058
260 Ga0160447_104189 3300012849 Bacteria 4348
261 Ga0160447_111450 3300012849 Unclassified 1874
262 Ga0264413_128010 3300024493 Bacteria 2187
263 Ga0415639_094377 3300038395 Bacteria 1916
264 Ga0466657_274200 3300042582 Bacteria 1480
265 Ga0466713_030327 3300042602 Bacteria 42897
266 Ga0466717_157661 3300042604 Bacteria 1053
267 Ga0466733_172907 3300042659 Bacteria 4931
268 Ga0562374_0005 3300057007 Bacteria 2987673
269 AustNasuHG_c1016596 3300000089 Bacteria 2461
270 Ga0074307_1140325 3300005313 Bacteria 638
271 Ga0105524_100022 3300007733 Bacteria 12817
272 Ga0123357_10902657 3300009784 Bacteria 570
273 Ga0123355_11501457 3300009826 Unclassified 657
274 Ga0123356_10116780 3300010049 Unclassified 2588
275 Ga0123353_10578012 3300010167 Bacteria 1613
276 Ga0123353_10752475 3300010167 Unclassified 1356
277 Ga0123354_10044897 3300010882 Bacteria 6769
278 Ga0466734_112137 3300042623 Unclassified 2098
279 Ga0466730_095014 3300042625 Bacteria 15821
280 Ga0466703_046239 3300042636 Bacteria 3981
281 Ga0466703_325455 3300042636 Bacteria 14564
282 Ga0466724_02361 3300042649 Bacteria 34785
283 Ga0466725_043483 3300042654 Bacteria 1243
284 Ga0466705_237471 3300042612 Bacteria 13038
285 Ga0466718_152904 3300042617 Bacteria 12214
286 Ga0466729_149689 3300042621 Bacteria 2665

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00203 Ribosomal_S19 Ribosomal protein S19 12 92 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.