Protein Family IF01838
Metagenome
Metatranscriptome
Isolate
480
Members
290
Samples
286
Scaffolds
92.93
Avg Length
Representative Sequence
- ID
- 3300007153|Ga0104050_1212085|Ga0104050_12120853
- Length
- 103 aa
- Sequence
- LLLRQWQTHGPRSLKKGPFVDDHLLRKVVKQNEAKSQNVIKTWSRRSMIVPAMLGHTIAVHDGRKHIPVFVTETMVGHKLGEFAPTRTFRGHVKDDKKGRRR*
Sample Types
Isolate
40.4%
Metagenome
58.3%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
24.0%
Termitidae
15.1%
Formicidae
7.5%
Apidae
5.4%
Kalotermitidae
4.7%
Scarabaeidae
4.3%
Anthocoridae
3.6%
Culicidae
3.6%
Cambaridae
3.2%
Tenebrionidae
3.2%
Elmidae
2.9%
Drosophilidae
2.9%
Armadillidiidae
2.2%
Pyralidae
1.8%
Chrysomelidae
1.8%
Rhinotermitidae
1.4%
Noctuidae
1.1%
Dytiscidae
1.1%
Hydrophilidae
1.1%
Termopsidae
1.1%
Curculionidae
0.7%
Bombycidae
0.7%
Eresidae
0.4%
Pentatomidae
0.4%
Penaeidae
0.4%
Portunidae
0.4%
Cimicidae
0.4%
Nephropidae
0.4%
Ocypodidae
0.4%
Thomisidae
0.4%
Calliphoridae
0.4%
Pseudococcidae
0.4%
Hodotermitidae
0.4%
Passalidae
0.4%
Siricidae
0.4%
Euphausiidae
0.4%
Chironomidae
0.4%
Ixodidae
0.4%
Reduviidae
0.4%
Cerambycidae
0.4%
Kiwaidae
0.4%
Taxonomy
Archaea
1
Bacteria
427
Eukaryota
0
Viruses
0
Unclassified
52
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 2 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 3 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 4 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 5 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 6 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 7 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 8 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 9 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 10 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 11 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 12 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 13 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 14 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 15 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 16 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 17 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 18 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 19 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 20 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 21 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 22 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 23 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 24 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 31 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 32 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 33 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 34 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 35 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 36 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 37 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 38 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 39 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 40 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 41 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 42 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 43 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 44 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 45 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 46 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 47 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 48 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 49 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 50 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 51 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 52 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 53 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 54 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 55 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 56 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 57 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 58 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 59 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 60 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 61 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 62 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 63 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 64 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 65 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 66 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 67 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 68 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 69 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 70 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 71 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 72 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 73 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 74 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 75 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 76 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 77 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 78 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 79 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 80 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 81 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 82 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 83 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 84 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 85 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 86 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 87 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 88 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 89 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 90 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 91 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 92 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 93 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 94 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 95 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 96 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 97 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 98 | 3300005313 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut | Metagenome | Drosophilidae |
| 99 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 100 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 101 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 102 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 103 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 104 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 105 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 106 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 107 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 108 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 109 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 110 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 111 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 112 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 113 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 114 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 115 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 116 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 117 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 118 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 119 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 120 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 121 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 122 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 123 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 124 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 125 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 126 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 127 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 128 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 129 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 130 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 131 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 132 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 133 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 134 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 135 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 136 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 137 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 138 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 139 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 140 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 141 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 142 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 143 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 144 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 145 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 146 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 147 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 148 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 149 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 150 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 151 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 152 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 153 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 154 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 155 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 156 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 157 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 158 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 159 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 160 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 161 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 162 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 163 | 650716018 | Candidatus Tremblaya princeps PCIT | Isolate | Pseudococcidae |
| 164 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 165 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 166 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 167 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 168 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 169 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 170 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 171 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 172 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 173 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 174 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 175 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 176 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 177 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 178 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 179 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 180 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 181 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 182 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 183 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 184 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 185 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 186 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 187 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 188 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 189 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 190 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 191 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 192 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 193 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 194 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 195 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 196 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 197 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 198 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 199 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 200 | 3300060896 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 201 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 202 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 203 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 204 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 205 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 206 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 207 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 208 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 209 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 210 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 211 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 212 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 213 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 214 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 215 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 216 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 217 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 218 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 219 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 220 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 221 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 222 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 223 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 224 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 225 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 226 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 227 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 228 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 229 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 230 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 231 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 232 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 233 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 234 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 235 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 236 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 237 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 238 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 239 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 240 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 241 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 242 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 243 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 244 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 245 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 246 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 247 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 248 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 249 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 250 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 251 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 252 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 253 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 254 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 255 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 256 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 257 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 258 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 259 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 260 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 261 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 262 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 263 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 264 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 265 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 266 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 267 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 268 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 269 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 270 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 271 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 272 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 273 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 274 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 275 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 276 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 277 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 278 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 279 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 280 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 281 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 282 | 3300005320 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut | Metagenome | Drosophilidae |
| 283 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 284 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 285 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 286 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 287 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 288 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 289 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 290 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160444_102085 | 3300012841 | Bacteria | 3192 |
| 2 | Ga0160430_100932 | 3300012852 | Unclassified | 12770 |
| 3 | Ga0160435_1028205 | 3300012857 | Bacteria | 911 |
| 4 | Ga0160436_1000191 | 3300012861 | Bacteria | 30420 |
| 5 | Ga0255809_1038726 | 3300022820 | Bacteria | 1228 |
| 6 | Ga0415639_095019 | 3300038395 | Bacteria | 3384 |
| 7 | Ga0466657_074188 | 3300042582 | Bacteria | 17452 |
| 8 | Ga0466696_357816 | 3300042596 | Bacteria | 5533 |
| 9 | Ga0466706_198118 | 3300042599 | Bacteria | 7169 |
| 10 | Ga0466713_092829 | 3300042602 | Unclassified | 1119 |
| 11 | Ga0466713_143014 | 3300042602 | Unclassified | 1023 |
| 12 | Ga0466717_202545 | 3300042604 | Unclassified | 1329 |
| 13 | Ga0466719_086513 | 3300042606 | Bacteria | 15067 |
| 14 | Ga0562379_0022 | 3300056790 | Bacteria | 931623 |
| 15 | Ga0562379_0100 | 3300056790 | Bacteria | 294662 |
| 16 | JGI24705J35276_12148859 | 3300002504 | Bacteria | 1174 |
| 17 | JGI24705J35276_12217339 | 3300002504 | Unclassified | 2088 |
| 18 | JGI24705J35276_12237980 | 3300002504 | Bacteria | 14674 |
| 19 | CVPL010L_1000082 | 3300002932 | Bacteria | 29431 |
| 20 | Ga0072940_1147464 | 3300005200 | Bacteria | 753 |
| 21 | Ga0104041_1112941 | 3300007106 | Bacteria | 1634 |
| 22 | Ga0123357_10001723 | 3300009784 | Bacteria | 23593 |
| 23 | Ga0123357_10521803 | 3300009784 | Bacteria | 970 |
| 24 | Ga0123356_10423204 | 3300010049 | Unclassified | 1474 |
| 25 | Ga0123356_11489444 | 3300010049 | Bacteria | 835 |
| 26 | Ga0123353_10001965 | 3300010167 | Bacteria | 25350 |
| 27 | Ga0123353_12541589 | 3300010167 | Bacteria | 608 |
| 28 | Ga0123354_11082892 | 3300010882 | Bacteria | 510 |
| 29 | Ga0466731_366030 | 3300042622 | Unclassified | 1317 |
| 30 | Ga0466734_168885 | 3300042623 | Bacteria | 1325 |
| 31 | Ga0466730_030052 | 3300042625 | Bacteria | 1063 |
| 32 | Ga0466725_194892 | 3300042654 | Bacteria | 1674 |
| 33 | Ga0466727_108937 | 3300042655 | Bacteria | 1391 |
| 34 | Ga0466705_150947 | 3300042612 | Bacteria | 2035 |
| 35 | Ga0466705_276363 | 3300042612 | Bacteria | 19722 |
| 36 | Ga0466715_562604 | 3300042616 | Bacteria | 3932 |
| 37 | Ga0160456_100878 | 3300012820 | Bacteria | 8059 |
| 38 | Ga0160455_101026 | 3300012837 | Bacteria | 9976 |
| 39 | Ga0160455_105580 | 3300012837 | Bacteria | 1357 |
| 40 | Ga0160434_125687 | 3300012850 | Unclassified | 865 |
| 41 | Ga0466692_152767 | 3300042591 | Unclassified | 1820 |
| 42 | Ga0466692_181714 | 3300042591 | Bacteria | 1778 |
| 43 | Ga0466691_018487 | 3300042593 | Bacteria | 80759 |
| 44 | Ga0466694_258653 | 3300042594 | Unclassified | 2190 |
| 45 | Ga0466700_162385 | 3300042600 | Bacteria | 12987 |
| 46 | Ga0466707_003303 | 3300042601 | Bacteria | 1183 |
| 47 | Ga0466713_024575 | 3300042602 | Bacteria | 38766 |
| 48 | Ga0466717_244400 | 3300042604 | Bacteria | 1483 |
| 49 | Ga0466722_216957 | 3300042609 | Bacteria | 6832 |
| 50 | Ga0562375_0206 | 3300056856 | Bacteria | 165734 |
| 51 | Ga0590775_01042 | 3300060896 | Bacteria | 3883 |
| 52 | CwormDRAF_NODE_3131_len_1871_cov_227_625336 | 2035265002 | Bacteria | 1901 |
| 53 | JGI24703J35330_11018770 | 3300002501 | Bacteria | 642 |
| 54 | JGI24699J35502_11122228 | 3300002509 | Unclassified | 3414 |
| 55 | Ga0074278_142794 | 3300005721 | Bacteria | 8443 |
| 56 | Ga0123357_10992084 | 3300009784 | Unclassified | 524 |
| 57 | Ga0123355_10136223 | 3300009826 | Bacteria | 3771 |
| 58 | Ga0123355_10821954 | 3300009826 | Bacteria | 1030 |
| 59 | Ga0123355_11689076 | 3300009826 | Unclassified | 604 |
| 60 | Ga0123356_10026024 | 3300010049 | Bacteria | 5499 |
| 61 | Ga0123356_10154107 | 3300010049 | Unclassified | 2286 |
| 62 | Ga0123356_11748082 | 3300010049 | Bacteria | 772 |
| 63 | Ga0123356_12464635 | 3300010049 | Unclassified | 651 |
| 64 | Ga0123356_13851465 | 3300010049 | Bacteria | 518 |
| 65 | Ga0466734_048236 | 3300042623 | Bacteria | 1683 |
| 66 | Ga0466734_065425 | 3300042623 | Unclassified | 1819 |
| 67 | Ga0466730_055821 | 3300042625 | Bacteria | 8238 |
| 68 | Ga0466730_077789 | 3300042625 | Bacteria | 2447 |
| 69 | Ga0466703_340076 | 3300042636 | Bacteria | 2362 |
| 70 | Ga0466703_372472 | 3300042636 | Archaea | 7762 |
| 71 | Ga0466727_119340 | 3300042655 | Bacteria | 6208 |
| 72 | Ga0466705_206890 | 3300042612 | Unclassified | 1277 |
| 73 | Ga0466705_311150 | 3300042612 | Bacteria | 166746 |
| 74 | Ga0466657_090451 | 3300042582 | Bacteria | 1690 |
| 75 | Ga0466692_079565 | 3300042591 | Bacteria | 1385 |
| 76 | Ga0466691_126587 | 3300042593 | Unclassified | 2351 |
| 77 | Ga0466706_025530 | 3300042599 | Bacteria | 5055 |
| 78 | Ga0466706_228981 | 3300042599 | Unclassified | 2031 |
| 79 | Ga0466716_539679 | 3300042605 | Bacteria | 1913 |
| 80 | Ga0466719_173271 | 3300042606 | Bacteria | 1008 |
| 81 | Ga0466697_030590 | 3300042611 | Bacteria | 1976 |
| 82 | Ga0466733_150248 | 3300042659 | Bacteria | 8066 |
| 83 | Ga0562379_0410 | 3300056790 | Bacteria | 93813 |
| 84 | Ga0562379_0489 | 3300056790 | Bacteria | 79810 |
| 85 | Ga0562377_0137 | 3300056842 | Bacteria | 212469 |
| 86 | Ga0562375_3896 | 3300056856 | Unclassified | 12659 |
| 87 | Ga0562374_2969 | 3300057007 | Bacteria | 11860 |
| 88 | IMNBGM34_c019248 | 3300000036 | Unclassified | 854 |
| 89 | AustNasuHG_c1039497 | 3300000089 | Bacteria | 1171 |
| 90 | Ga0052191_100638 | 3300003097 | Bacteria | 1901 |
| 91 | Ga0105524_101309 | 3300007733 | Bacteria | 18026 |
| 92 | Ga0123355_10002085 | 3300009826 | Bacteria | 28219 |
| 93 | Ga0123355_10003652 | 3300009826 | Bacteria | 22170 |
| 94 | Ga0123356_10110004 | 3300010049 | Bacteria | 2660 |
| 95 | Ga0123356_12491985 | 3300010049 | Bacteria | 647 |
| 96 | Ga0123353_10654171 | 3300010167 | Bacteria | 1487 |
| 97 | Ga0123353_12603164 | 3300010167 | Unclassified | 599 |
| 98 | Ga0123354_10340563 | 3300010882 | Unclassified | 1352 |
| 99 | Ga0123354_10476083 | 3300010882 | Bacteria | 991 |
| 100 | Ga0123354_10853586 | 3300010882 | Unclassified | 604 |
| 101 | Ga0123354_10931412 | 3300010882 | Bacteria | 566 |
| 102 | Ga0466731_005499 | 3300042622 | Bacteria | 2596 |
| 103 | Ga0466731_176442 | 3300042622 | Bacteria | 1769 |
| 104 | Ga0466734_013378 | 3300042623 | Bacteria | 1396 |
| 105 | Ga0466734_138845 | 3300042623 | Bacteria | 2628 |
| 106 | Ga0466730_070672 | 3300042625 | Unclassified | 1742 |
| 107 | Ga0466702_463679 | 3300042635 | Bacteria | 3046 |
| 108 | Ga0466725_406302 | 3300042654 | Unclassified | 1877 |
| 109 | Ga0466727_301924 | 3300042655 | Bacteria | 7055 |
| 110 | Ga0466718_138336 | 3300042617 | Bacteria | 1885 |
| 111 | Ga0466723_178188 | 3300042618 | Bacteria | 1854 |
| 112 | Ga0466723_220679 | 3300042618 | Bacteria | 5167 |
| 113 | Ga0160447_118283 | 3300012849 | Unclassified | 1197 |
| 114 | Ga0160457_1037109 | 3300012858 | Bacteria | 662 |
| 115 | Ga0157631_103502 | 3300013007 | Bacteria | 4449 |
| 116 | Ga0223687_100094 | 3300021217 | Bacteria | 12922 |
| 117 | Ga0466706_118984 | 3300042599 | Bacteria | 1057 |
| 118 | Ga0466706_154978 | 3300042599 | Bacteria | 125008 |
| 119 | Ga0466716_344665 | 3300042605 | Bacteria | 4778 |
| 120 | Ga0466733_131946 | 3300042659 | Bacteria | 20509 |
| 121 | Ga0104019_1029748 | 3300007150 | Bacteria | 1562 |
| 122 | Ga0123357_10000801 | 3300009784 | Bacteria | 31843 |
| 123 | Ga0123357_10129647 | 3300009784 | Bacteria | 3146 |
| 124 | Ga0123357_10325022 | 3300009784 | Bacteria | 1513 |
| 125 | Ga0123355_10192841 | 3300009826 | Unclassified | 2996 |
| 126 | Ga0123355_10892810 | 3300009826 | Unclassified | 968 |
| 127 | Ga0123356_10004286 | 3300010049 | Bacteria | 14755 |
| 128 | Ga0123356_10025041 | 3300010049 | Bacteria | 5609 |
| 129 | Ga0123356_10080711 | 3300010049 | Bacteria | 3076 |
| 130 | Ga0123354_10002396 | 3300010882 | Bacteria | 24675 |
| 131 | Ga0123354_10031618 | 3300010882 | Bacteria | 8300 |
| 132 | Ga0123354_10606064 | 3300010882 | Unclassified | 800 |
| 133 | Ga0123354_10799702 | 3300010882 | Unclassified | 636 |
| 134 | Ga0160466_101685 | 3300012809 | Bacteria | 5385 |
| 135 | Ga0466729_208868 | 3300042621 | Bacteria | 4517 |
| 136 | Ga0466729_248897 | 3300042621 | Unclassified | 2454 |
| 137 | Ga0466735_129467 | 3300042624 | Bacteria | 2323 |
| 138 | Ga0466704_180303 | 3300042643 | Unclassified | 4498 |
| 139 | Ga0466709_052786 | 3300042648 | Bacteria | 2017 |
| 140 | Ga0466724_12518 | 3300042649 | Bacteria | 3451 |
| 141 | Ga0466697_259946 | 3300042611 | Bacteria | 1006 |
| 142 | Ga0466715_322665 | 3300042616 | Bacteria | 16211 |
| 143 | Ga0160435_1015353 | 3300012857 | Bacteria | 1464 |
| 144 | Ga0223682_1017386 | 3300021231 | Unclassified | 981 |
| 145 | Ga0466693_153344 | 3300042592 | Bacteria | 1527 |
| 146 | Ga0466706_099650 | 3300042599 | Bacteria | 1150 |
| 147 | Ga0466707_086104 | 3300042601 | Bacteria | 138731 |
| 148 | Ga0466707_287085 | 3300042601 | Bacteria | 1030 |
| 149 | Ga0466707_302603 | 3300042601 | Bacteria | 62986 |
| 150 | Ga0466713_036385 | 3300042602 | Unclassified | 2719 |
| 151 | Ga0466720_192207 | 3300042607 | Bacteria | 1109 |
| 152 | Ga0466733_010171 | 3300042659 | Bacteria | 4019 |
| 153 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 154 | Ga0562377_0135 | 3300056842 | Bacteria | 217276 |
| 155 | Ga0562376_2795 | 3300056857 | Bacteria | 19515 |
| 156 | Ga0562376_3020 | 3300056857 | Bacteria | 18242 |
| 157 | JGI24695J34938_10014000 | 3300002450 | Bacteria | 4183 |
| 158 | JGI24705J35276_11847251 | 3300002504 | Bacteria | 713 |
| 159 | JGI24699J35502_10723643 | 3300002509 | Bacteria | 789 |
| 160 | Ga0072941_1015847 | 3300005201 | Bacteria | 35185 |
| 161 | Ga0074317_1169576 | 3300005320 | Bacteria | 581 |
| 162 | Ga0123357_10101253 | 3300009784 | Bacteria | 3713 |
| 163 | Ga0123355_10006887 | 3300009826 | Bacteria | 16926 |
| 164 | Ga0123355_10534016 | 3300009826 | Unclassified | 1427 |
| 165 | Ga0123355_10902533 | 3300009826 | Bacteria | 960 |
| 166 | Ga0123355_11984928 | 3300009826 | Unclassified | 540 |
| 167 | Ga0123355_12088304 | 3300009826 | Unclassified | 522 |
| 168 | Ga0123356_10846047 | 3300010049 | Bacteria | 1086 |
| 169 | Ga0123353_11862112 | 3300010167 | Bacteria | 744 |
| 170 | Ga0466729_283145 | 3300042621 | Bacteria | 1064 |
| 171 | Ga0466734_155361 | 3300042623 | Unclassified | 1618 |
| 172 | Ga0466730_002774 | 3300042625 | Bacteria | 2535 |
| 173 | Ga0466724_28716 | 3300042649 | Bacteria | 223742 |
| 174 | Ga0466708_305231 | 3300042652 | Unclassified | 1600 |
| 175 | Ga0466725_086625 | 3300042654 | Bacteria | 5211 |
| 176 | Ga0466710_345768 | 3300042613 | Bacteria | 1178 |
| 177 | Ga0466726_207627 | 3300042619 | Bacteria | 1324 |
| 178 | Ga0466728_416312 | 3300042620 | Bacteria | 6638 |
| 179 | Ga0160468_104669 | 3300012819 | Bacteria | 1626 |
| 180 | Ga0160446_111079 | 3300012835 | Unclassified | 1136 |
| 181 | Ga0160472_117505 | 3300012839 | Bacteria | 738 |
| 182 | Ga0160444_111275 | 3300012841 | Bacteria | 1078 |
| 183 | Ga0160460_105136 | 3300012845 | Bacteria | 1913 |
| 184 | Ga0223683_1019425 | 3300021245 | Bacteria | 806 |
| 185 | Ga0415639_241421 | 3300038395 | Unclassified | 1515 |
| 186 | Ga0466656_344090 | 3300042550 | Bacteria | 1262 |
| 187 | Ga0466657_241321 | 3300042582 | Bacteria | 1814 |
| 188 | Ga0466696_184466 | 3300042596 | Bacteria | 1138 |
| 189 | Ga0466707_175608 | 3300042601 | Bacteria | 13441 |
| 190 | Ga0466713_013445 | 3300042602 | Bacteria | 31659 |
| 191 | Ga0466713_123340 | 3300042602 | Bacteria | 1498 |
| 192 | Ga0466733_025245 | 3300042659 | Bacteria | 172347 |
| 193 | Ga0562374_0013 | 3300057007 | Bacteria | 1517757 |
| 194 | JGI24705J35276_12219906 | 3300002504 | Bacteria | 2233 |
| 195 | Ga0104050_1212085 | 3300007153 | Bacteria | 911 |
| 196 | Ga0123357_10167563 | 3300009784 | Bacteria | 2610 |
| 197 | Ga0123355_11181028 | 3300009826 | Bacteria | 784 |
| 198 | Ga0123353_10003840 | 3300010167 | Bacteria | 19170 |
| 199 | Ga0123353_11162817 | 3300010167 | Bacteria | 1017 |
| 200 | Ga0123353_11917199 | 3300010167 | Bacteria | 730 |
| 201 | Ga0123354_10004680 | 3300010882 | Bacteria | 19492 |
| 202 | Ga0123354_10035070 | 3300010882 | Bacteria | 7836 |
| 203 | Ga0123354_10115333 | 3300010882 | Bacteria | 3512 |
| 204 | Ga0123354_10189312 | 3300010882 | Bacteria | 2311 |
| 205 | Ga0466734_134621 | 3300042623 | Bacteria | 3084 |
| 206 | Ga0466735_002942 | 3300042624 | Bacteria | 1866 |
| 207 | Ga0466735_228119 | 3300042624 | Bacteria | 1256 |
| 208 | Ga0466730_007810 | 3300042625 | Bacteria | 11605 |
| 209 | Ga0466730_044927 | 3300042625 | Bacteria | 3039 |
| 210 | Ga0466703_243244 | 3300042636 | Unclassified | 2465 |
| 211 | Ga0466703_416321 | 3300042636 | Bacteria | 11405 |
| 212 | Ga0466704_582723 | 3300042643 | Bacteria | 43560 |
| 213 | Ga0466724_64838 | 3300042649 | Bacteria | 17323 |
| 214 | Ga0466725_219676 | 3300042654 | Bacteria | 1458 |
| 215 | Ga0466710_311777 | 3300042613 | Bacteria | 6061 |
| 216 | Ga0466711_384397 | 3300042615 | Bacteria | 4317 |
| 217 | Ga0466729_156052 | 3300042621 | Bacteria | 12586 |
| 218 | Ga0466729_158104 | 3300042621 | Bacteria | 83475 |
| 219 | Ga0160432_100761 | 3300012818 | Bacteria | 15685 |
| 220 | Ga0160459_109573 | 3300012831 | Unclassified | 1175 |
| 221 | Ga0160433_107479 | 3300012846 | Bacteria | 1503 |
| 222 | Ga0160434_100001 | 3300012850 | Bacteria | 617314 |
| 223 | Ga0160434_134878 | 3300012850 | Bacteria | 690 |
| 224 | Ga0223686_1013240 | 3300021244 | Bacteria | 1134 |
| 225 | Ga0466693_110507 | 3300042592 | Bacteria | 60686 |
| 226 | Ga0466693_353530 | 3300042592 | Bacteria | 63745 |
| 227 | Ga0466694_257882 | 3300042594 | Bacteria | 3725 |
| 228 | Ga0466696_453420 | 3300042596 | Bacteria | 1176 |
| 229 | Ga0466707_221470 | 3300042601 | Bacteria | 71824 |
| 230 | Ga0466713_101616 | 3300042602 | Bacteria | 503322 |
| 231 | Ga0466722_035212 | 3300042609 | Bacteria | 19731 |
| 232 | Ga0466697_055560 | 3300042611 | Bacteria | 2670 |
| 233 | Ga0466733_013454 | 3300042659 | Bacteria | 3737 |
| 234 | Ga0562379_0066 | 3300056790 | Bacteria | 440869 |
| 235 | Ga0562376_0381 | 3300056857 | Bacteria | 84233 |
| 236 | JGI24699J35502_10455235 | 3300002509 | Bacteria | 591 |
| 237 | Ga0072941_1064399 | 3300005201 | Bacteria | 1334 |
| 238 | Ga0104048_1137616 | 3300007143 | Bacteria | 578 |
| 239 | Ga0123357_10000864 | 3300009784 | Bacteria | 30882 |
| 240 | Ga0123357_10081341 | 3300009784 | Unclassified | 4258 |
| 241 | Ga0123357_10899687 | 3300009784 | Bacteria | 572 |
| 242 | Ga0123356_11698901 | 3300010049 | Bacteria | 783 |
| 243 | Ga0123353_10839554 | 3300010167 | Bacteria | 1261 |
| 244 | Ga0123354_10185721 | 3300010882 | Bacteria | 2353 |
| 245 | Ga0466734_005313 | 3300042623 | Bacteria | 1457 |
| 246 | Ga0466734_063643 | 3300042623 | Bacteria | 3376 |
| 247 | Ga0466730_028064 | 3300042625 | Bacteria | 1269 |
| 248 | Ga0466730_038413 | 3300042625 | Unclassified | 1565 |
| 249 | Ga0466703_115413 | 3300042636 | Bacteria | 35262 |
| 250 | Ga0466703_429535 | 3300042636 | Bacteria | 36032 |
| 251 | Ga0466704_604583 | 3300042643 | Bacteria | 1900 |
| 252 | Ga0466704_611769 | 3300042643 | Bacteria | 3580 |
| 253 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 254 | Ga0466727_061146 | 3300042655 | Bacteria | 1712 |
| 255 | Ga0466697_118605 | 3300042611 | Bacteria | 1071 |
| 256 | Ga0466705_129627 | 3300042612 | Bacteria | 1291 |
| 257 | Ga0466712_080838 | 3300042614 | Bacteria | 1798 |
| 258 | Ga0466711_253939 | 3300042615 | Bacteria | 18586 |
| 259 | Ga0466726_267387 | 3300042619 | Unclassified | 2058 |
| 260 | Ga0160447_104189 | 3300012849 | Bacteria | 4348 |
| 261 | Ga0160447_111450 | 3300012849 | Unclassified | 1874 |
| 262 | Ga0264413_128010 | 3300024493 | Bacteria | 2187 |
| 263 | Ga0415639_094377 | 3300038395 | Bacteria | 1916 |
| 264 | Ga0466657_274200 | 3300042582 | Bacteria | 1480 |
| 265 | Ga0466713_030327 | 3300042602 | Bacteria | 42897 |
| 266 | Ga0466717_157661 | 3300042604 | Bacteria | 1053 |
| 267 | Ga0466733_172907 | 3300042659 | Bacteria | 4931 |
| 268 | Ga0562374_0005 | 3300057007 | Bacteria | 2987673 |
| 269 | AustNasuHG_c1016596 | 3300000089 | Bacteria | 2461 |
| 270 | Ga0074307_1140325 | 3300005313 | Bacteria | 638 |
| 271 | Ga0105524_100022 | 3300007733 | Bacteria | 12817 |
| 272 | Ga0123357_10902657 | 3300009784 | Bacteria | 570 |
| 273 | Ga0123355_11501457 | 3300009826 | Unclassified | 657 |
| 274 | Ga0123356_10116780 | 3300010049 | Unclassified | 2588 |
| 275 | Ga0123353_10578012 | 3300010167 | Bacteria | 1613 |
| 276 | Ga0123353_10752475 | 3300010167 | Unclassified | 1356 |
| 277 | Ga0123354_10044897 | 3300010882 | Bacteria | 6769 |
| 278 | Ga0466734_112137 | 3300042623 | Unclassified | 2098 |
| 279 | Ga0466730_095014 | 3300042625 | Bacteria | 15821 |
| 280 | Ga0466703_046239 | 3300042636 | Bacteria | 3981 |
| 281 | Ga0466703_325455 | 3300042636 | Bacteria | 14564 |
| 282 | Ga0466724_02361 | 3300042649 | Bacteria | 34785 |
| 283 | Ga0466725_043483 | 3300042654 | Bacteria | 1243 |
| 284 | Ga0466705_237471 | 3300042612 | Bacteria | 13038 |
| 285 | Ga0466718_152904 | 3300042617 | Bacteria | 12214 |
| 286 | Ga0466729_149689 | 3300042621 | Bacteria | 2665 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 12 | 92 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.