Protein Family IF01799
Metagenome
Isolate
228
Members
65
Samples
213
Scaffolds
188.22
Avg Length
Representative Sequence
- ID
- 3300007143|Ga0104048_1022679|Ga0104048_10226791
- Length
- 193 aa
- Sequence
- MTKEKKENLTLDRIILGIDPGTTIMGFGLIRVVNKQMEFIQLNELQLNKYDDHYTKLRRIFERTMELIETHCPDEIAIEAPFFGKNVQSMLKLGRAQGVAMAAGLSRGIPITEYEPKKIKMAITGNGNASKEQVAKMLQQLLGLKELPKNLDSTDGLAAAVCHFFNSGKTVVGKSYSGWDAFVKQNQDRVKK*
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.7%
Kalotermitidae
21.9%
Unclassified
12.5%
Drosophilidae
6.2%
Blattidae
6.2%
Rhinotermitidae
4.7%
Termopsidae
4.7%
Elmidae
3.1%
Passalidae
3.1%
Daphniidae
1.6%
Cambaridae
1.6%
Formicidae
1.6%
Hodotermitidae
1.6%
Nephropidae
1.6%
Taxonomy
Archaea
0
Bacteria
211
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 3 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 13 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 14 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 19 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 22 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 38 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 47 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 48 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 49 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 54 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 55 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 59 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_174530 | 3300042659 | Bacteria | 16715 |
| 2 | Ga0123357_10025383 | 3300009784 | Bacteria | 7994 |
| 3 | Ga0123357_10268687 | 3300009784 | Bacteria | 1787 |
| 4 | Ga0123356_10423054 | 3300010049 | Bacteria | 1475 |
| 5 | Ga0123354_10202706 | 3300010882 | Unclassified | 2174 |
| 6 | Ga0466692_097478 | 3300042591 | Bacteria | 3033 |
| 7 | Ga0466692_176056 | 3300042591 | Bacteria | 1916 |
| 8 | Ga0466692_201555 | 3300042591 | Unclassified | 1539 |
| 9 | Ga0466693_178234 | 3300042592 | Bacteria | 2002 |
| 10 | Ga0466691_015459 | 3300042593 | Bacteria | 5696 |
| 11 | Ga0466696_392853 | 3300042596 | Bacteria | 1622 |
| 12 | Ga0466735_018793 | 3300042624 | Bacteria | 5909 |
| 13 | Ga0466709_095978 | 3300042648 | Bacteria | 34809 |
| 14 | Ga0466727_176346 | 3300042655 | Bacteria | 17609 |
| 15 | Ga0466727_334302 | 3300042655 | Bacteria | 12824 |
| 16 | 2227638495 | 2225789004 | Bacteria | 11160 |
| 17 | JGI24702J35022_10001587 | 3300002462 | Bacteria | 14068 |
| 18 | JGI24702J35022_10040885 | 3300002462 | Bacteria | 2473 |
| 19 | JGI24705J35276_12158470 | 3300002504 | Bacteria | 1219 |
| 20 | JGI24699J35502_11133642 | 3300002509 | Bacteria | 12864 |
| 21 | Ga0104048_1022679 | 3300007143 | Bacteria | 4310 |
| 22 | Ga0466711_060092 | 3300042615 | Unclassified | 5120 |
| 23 | Ga0466723_036383 | 3300042618 | Bacteria | 10790 |
| 24 | Ga0466723_164166 | 3300042618 | Bacteria | 2791 |
| 25 | Ga0466729_154471 | 3300042621 | Bacteria | 26996 |
| 26 | Ga0466701_029840 | 3300042598 | Bacteria | 102818 |
| 27 | Ga0466700_058225 | 3300042600 | Bacteria | 3305 |
| 28 | Ga0466700_199670 | 3300042600 | Bacteria | 4193 |
| 29 | Ga0466707_038429 | 3300042601 | Bacteria | 31367 |
| 30 | Ga0466713_067679 | 3300042602 | Bacteria | 29895 |
| 31 | Ga0466719_439434 | 3300042606 | Bacteria | 7674 |
| 32 | Ga0466697_172265 | 3300042611 | Bacteria | 5306 |
| 33 | Ga0466705_157007 | 3300042612 | Bacteria | 6679 |
| 34 | Ga0123357_10042199 | 3300009784 | Bacteria | 6203 |
| 35 | Ga0123357_10108205 | 3300009784 | Bacteria | 3556 |
| 36 | Ga0123354_10030612 | 3300010882 | Bacteria | 8449 |
| 37 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 38 | Ga0466693_203628 | 3300042592 | Bacteria | 2308 |
| 39 | Ga0466691_023015 | 3300042593 | Bacteria | 13261 |
| 40 | Ga0466691_037646 | 3300042593 | Bacteria | 9432 |
| 41 | Ga0466694_351087 | 3300042594 | Bacteria | 2621 |
| 42 | Ga0466696_352436 | 3300042596 | Bacteria | 3323 |
| 43 | Ga0466696_379785 | 3300042596 | Bacteria | 15194 |
| 44 | Ga0466735_018171 | 3300042624 | Bacteria | 4250 |
| 45 | Ga0466735_056025 | 3300042624 | Bacteria | 1896 |
| 46 | Ga0466709_389939 | 3300042648 | Bacteria | 3877 |
| 47 | Ga0466708_016786 | 3300042652 | Bacteria | 8829 |
| 48 | Ga0466708_176791 | 3300042652 | Bacteria | 38975 |
| 49 | Ga0466727_024869 | 3300042655 | Bacteria | 2411 |
| 50 | Ga0466727_322923 | 3300042655 | Bacteria | 4838 |
| 51 | Ga0068305_10073993 | 3300005083 | Bacteria | 6876 |
| 52 | Ga0104045_1008007 | 3300007085 | Unclassified | 2581 |
| 53 | Ga0466715_051157 | 3300042616 | Bacteria | 50381 |
| 54 | Ga0466715_332974 | 3300042616 | Bacteria | 9767 |
| 55 | Ga0466718_121661 | 3300042617 | Bacteria | 1350 |
| 56 | Ga0466728_030716 | 3300042620 | Bacteria | 7534 |
| 57 | Ga0466728_262745 | 3300042620 | Bacteria | 20432 |
| 58 | Ga0466700_229482 | 3300042600 | Bacteria | 1385 |
| 59 | Ga0466707_194915 | 3300042601 | Bacteria | 10556 |
| 60 | Ga0466716_295477 | 3300042605 | Bacteria | 3606 |
| 61 | Ga0466719_361408 | 3300042606 | Bacteria | 1567 |
| 62 | Ga0466722_104373 | 3300042609 | Bacteria | 4820 |
| 63 | Ga0466722_265423 | 3300042609 | Bacteria | 6286 |
| 64 | Ga0466705_381693 | 3300042612 | Bacteria | 6883 |
| 65 | Ga0466733_137759 | 3300042659 | Bacteria | 1717 |
| 66 | Ga0123356_11622544 | 3300010049 | Bacteria | 801 |
| 67 | Ga0123354_10144380 | 3300010882 | Bacteria | 2923 |
| 68 | Ga0123354_10165935 | 3300010882 | Bacteria | 2596 |
| 69 | Ga0466690_242016 | 3300042590 | Bacteria | 6738 |
| 70 | Ga0466696_034053 | 3300042596 | Bacteria | 2941 |
| 71 | Ga0466696_316510 | 3300042596 | Bacteria | 1868 |
| 72 | Ga0466696_401770 | 3300042596 | Bacteria | 6239 |
| 73 | Ga0466735_092940 | 3300042624 | Bacteria | 11195 |
| 74 | Ga0466735_123543 | 3300042624 | Bacteria | 5219 |
| 75 | Ga0466703_403993 | 3300042636 | Bacteria | 7111 |
| 76 | Ga0466704_159234 | 3300042643 | Bacteria | 2370 |
| 77 | Ga0466704_512887 | 3300042643 | Bacteria | 32913 |
| 78 | Ga0466708_121931 | 3300042652 | Bacteria | 6038 |
| 79 | Ga0466727_126733 | 3300042655 | Bacteria | 3918 |
| 80 | 2227239128 | 2225789004 | Bacteria | 7254 |
| 81 | 2227577118 | 2225789004 | Bacteria | 2550 |
| 82 | IMNBL1DRAFT_c0021035 | 3300000062 | Bacteria | 2622 |
| 83 | JGI24702J35022_10005248 | 3300002462 | Bacteria | 7596 |
| 84 | JGI24702J35022_10024217 | 3300002462 | Bacteria | 3280 |
| 85 | Ga0123357_10000658 | 3300009784 | Bacteria | 34456 |
| 86 | Ga0466710_396433 | 3300042613 | Bacteria | 9234 |
| 87 | Ga0466711_035612 | 3300042615 | Bacteria | 1750 |
| 88 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 89 | Ga0466711_106532 | 3300042615 | Bacteria | 6085 |
| 90 | Ga0466729_106410 | 3300042621 | Bacteria | 6208 |
| 91 | Ga0466701_035122 | 3300042598 | Bacteria | 8308 |
| 92 | Ga0466700_044713 | 3300042600 | Bacteria | 11766 |
| 93 | Ga0466707_135985 | 3300042601 | Bacteria | 9923 |
| 94 | Ga0466707_219271 | 3300042601 | Bacteria | 3698 |
| 95 | Ga0466707_281895 | 3300042601 | Bacteria | 3877 |
| 96 | Ga0466713_080837 | 3300042602 | Bacteria | 14389 |
| 97 | Ga0466716_379137 | 3300042605 | Bacteria | 10862 |
| 98 | Ga0466719_239832 | 3300042606 | Bacteria | 5925 |
| 99 | Ga0466698_026479 | 3300042610 | Bacteria | 2043 |
| 100 | Ga0123357_10025165 | 3300009784 | Bacteria | 8025 |
| 101 | Ga0466690_184736 | 3300042590 | Bacteria | 19485 |
| 102 | Ga0466690_330752 | 3300042590 | Bacteria | 9285 |
| 103 | Ga0466693_398054 | 3300042592 | Bacteria | 2670 |
| 104 | Ga0466694_164679 | 3300042594 | Bacteria | 1063 |
| 105 | Ga0466696_184153 | 3300042596 | Bacteria | 23807 |
| 106 | Ga0466696_501557 | 3300042596 | Unclassified | 2898 |
| 107 | Ga0466729_274368 | 3300042621 | Unclassified | 7544 |
| 108 | Ga0466735_004173 | 3300042624 | Bacteria | 12455 |
| 109 | Ga0466735_074801 | 3300042624 | Bacteria | 2334 |
| 110 | Ga0466703_017186 | 3300042636 | Bacteria | 5189 |
| 111 | Ga0466704_121098 | 3300042643 | Bacteria | 24308 |
| 112 | Ga0466704_422608 | 3300042643 | Bacteria | 8471 |
| 113 | Ga0466704_487466 | 3300042643 | Bacteria | 6161 |
| 114 | JGI24699J35502_11134029 | 3300002509 | Bacteria | 25256 |
| 115 | Ga0074308_1117999 | 3300005307 | Unclassified | 945 |
| 116 | Ga0103265_1000034 | 3300007068 | Bacteria | 23271 |
| 117 | Ga0466715_510538 | 3300042616 | Bacteria | 2232 |
| 118 | Ga0466726_017819 | 3300042619 | Bacteria | 7967 |
| 119 | Ga0466726_175041 | 3300042619 | Bacteria | 1887 |
| 120 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 121 | Ga0466707_369886 | 3300042601 | Bacteria | 5495 |
| 122 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 123 | Ga0466716_152229 | 3300042605 | Bacteria | 6135 |
| 124 | Ga0466716_171810 | 3300042605 | Bacteria | 8024 |
| 125 | Ga0466719_211719 | 3300042606 | Bacteria | 1200 |
| 126 | Ga0466722_256018 | 3300042609 | Bacteria | 3948 |
| 127 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 128 | Ga0466705_084401 | 3300042612 | Bacteria | 19488 |
| 129 | Ga0466727_351836 | 3300042655 | Bacteria | 2906 |
| 130 | Ga0123357_10154833 | 3300009784 | Unclassified | 2768 |
| 131 | Ga0123353_10483559 | 3300010167 | Bacteria | 1811 |
| 132 | Ga0466656_309631 | 3300042550 | Bacteria | 2697 |
| 133 | Ga0466690_161857 | 3300042590 | Bacteria | 15085 |
| 134 | Ga0466696_192414 | 3300042596 | Unclassified | 2027 |
| 135 | Ga0466696_241827 | 3300042596 | Bacteria | 9775 |
| 136 | Ga0466696_451467 | 3300042596 | Bacteria | 1729 |
| 137 | Ga0466703_127125 | 3300042636 | Bacteria | 44060 |
| 138 | Ga0466704_409426 | 3300042643 | Bacteria | 6093 |
| 139 | IMNBL1DRAFT_c0001037 | 3300000062 | Bacteria | 21542 |
| 140 | Ga0068305_10134251 | 3300005083 | Unclassified | 6686 |
| 141 | Ga0104048_1168761 | 3300007143 | Unclassified | 2928 |
| 142 | Ga0123357_10000516 | 3300009784 | Bacteria | 37764 |
| 143 | Ga0466710_040696 | 3300042613 | Bacteria | 13162 |
| 144 | Ga0466711_053448 | 3300042615 | Bacteria | 4600 |
| 145 | Ga0466718_050736 | 3300042617 | Bacteria | 1543 |
| 146 | Ga0466701_064663 | 3300042598 | Bacteria | 3900 |
| 147 | Ga0466707_353315 | 3300042601 | Bacteria | 2198 |
| 148 | Ga0466713_148662 | 3300042602 | Bacteria | 25209 |
| 149 | Ga0466719_117183 | 3300042606 | Bacteria | 13535 |
| 150 | Ga0466719_125031 | 3300042606 | Bacteria | 11764 |
| 151 | Ga0466719_258503 | 3300042606 | Bacteria | 4142 |
| 152 | Ga0466719_379318 | 3300042606 | Bacteria | 3079 |
| 153 | Ga0123357_10389355 | 3300009784 | Bacteria | 1283 |
| 154 | Ga0123356_10167849 | 3300010049 | Bacteria | 2201 |
| 155 | Ga0123356_10261691 | 3300010049 | Unclassified | 1814 |
| 156 | Ga0123356_11966749 | 3300010049 | Bacteria | 729 |
| 157 | Ga0123353_10444555 | 3300010167 | Bacteria | 1911 |
| 158 | Ga0123354_10062928 | 3300010882 | Bacteria | 5457 |
| 159 | Ga0123354_10145273 | 3300010882 | Bacteria | 2907 |
| 160 | Ga0466657_028641 | 3300042582 | Bacteria | 2100 |
| 161 | Ga0466690_159683 | 3300042590 | Bacteria | 4437 |
| 162 | Ga0466692_182601 | 3300042591 | Bacteria | 5348 |
| 163 | Ga0466696_336173 | 3300042596 | Bacteria | 7232 |
| 164 | Ga0466734_169367 | 3300042623 | Bacteria | 2792 |
| 165 | Ga0466734_170437 | 3300042623 | Bacteria | 2505 |
| 166 | Ga0466735_091878 | 3300042624 | Bacteria | 1107 |
| 167 | Ga0466735_139523 | 3300042624 | Bacteria | 1029 |
| 168 | Ga0466703_029176 | 3300042636 | Bacteria | 3874 |
| 169 | Ga0466708_141133 | 3300042652 | Bacteria | 11097 |
| 170 | 2227565210 | 2225789004 | Bacteria | 2676 |
| 171 | 2227567425 | 2225789004 | Bacteria | 2653 |
| 172 | JGI24702J35022_10008903 | 3300002462 | Bacteria | 5660 |
| 173 | JGI24699J35502_11132882 | 3300002509 | Bacteria | 7863 |
| 174 | Ga0104050_1004133 | 3300007153 | Unclassified | 7415 |
| 175 | Ga0466710_327504 | 3300042613 | Bacteria | 1163 |
| 176 | Ga0466715_051890 | 3300042616 | Bacteria | 8307 |
| 177 | Ga0466715_145856 | 3300042616 | Bacteria | 12490 |
| 178 | Ga0466700_094231 | 3300042600 | Bacteria | 6040 |
| 179 | Ga0466707_139371 | 3300042601 | Bacteria | 11636 |
| 180 | Ga0466713_134751 | 3300042602 | Bacteria | 25892 |
| 181 | Ga0466722_145294 | 3300042609 | Bacteria | 16440 |
| 182 | Ga0123357_10004228 | 3300009784 | Bacteria | 16758 |
| 183 | Ga0123357_10005111 | 3300009784 | Bacteria | 15639 |
| 184 | Ga0123356_10754060 | 3300010049 | Unclassified | 1143 |
| 185 | Ga0466696_249291 | 3300042596 | Bacteria | 1830 |
| 186 | Ga0466696_394657 | 3300042596 | Bacteria | 6367 |
| 187 | Ga0466735_197225 | 3300042624 | Bacteria | 5022 |
| 188 | Ga0466735_210297 | 3300042624 | Bacteria | 4874 |
| 189 | Ga0466703_115731 | 3300042636 | Bacteria | 18685 |
| 190 | Ga0466704_017264 | 3300042643 | Bacteria | 18794 |
| 191 | Ga0466709_415777 | 3300042648 | Bacteria | 5248 |
| 192 | Ga0466727_052853 | 3300042655 | Bacteria | 1200 |
| 193 | Ga0466727_205369 | 3300042655 | Bacteria | 6688 |
| 194 | JGI24699J35502_11133259 | 3300002509 | Bacteria | 9499 |
| 195 | Ga0068305_10355616 | 3300005083 | Unclassified | 3656 |
| 196 | Ga0466705_477897 | 3300042612 | Bacteria | 1022 |
| 197 | Ga0466706_221023 | 3300042599 | Bacteria | 3876 |
| 198 | Ga0466707_111222 | 3300042601 | Bacteria | 14094 |
| 199 | Ga0123357_10109595 | 3300009784 | Bacteria | 3527 |
| 200 | Ga0466693_383077 | 3300042592 | Unclassified | 1053 |
| 201 | Ga0466691_150273 | 3300042593 | Bacteria | 1891 |
| 202 | Ga0466735_181240 | 3300042624 | Bacteria | 5198 |
| 203 | Ga0466735_206468 | 3300042624 | Bacteria | 2327 |
| 204 | Ga0466703_069360 | 3300042636 | Bacteria | 5378 |
| 205 | 2227601574 | 2225789004 | Bacteria | 2333 |
| 206 | IMNBL1DRAFT_c0000734 | 3300000062 | Bacteria | 25991 |
| 207 | Ga0068305_10230162 | 3300005083 | Bacteria | 6898 |
| 208 | Ga0466726_203345 | 3300042619 | Bacteria | 4851 |
| 209 | Ga0466726_416036 | 3300042619 | Bacteria | 2006 |
| 210 | Ga0466700_285303 | 3300042600 | Unclassified | 6790 |
| 211 | Ga0466700_287722 | 3300042600 | Bacteria | 5900 |
| 212 | Ga0466713_041413 | 3300042602 | Bacteria | 7528 |
| 213 | Ga0466716_360782 | 3300042605 | Bacteria | 9012 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02075 | RuvC | Crossover junction endodeoxyribonuclease RuvC | 15 | 163 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.