Protein Family IF01381
Metagenome
Isolate
136
Members
40
Samples
133
Scaffolds
91.14
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1552164|Ga0072941_15521642
- Length
- 99 aa
- Sequence
- MEIVGNMKYTPYYTNRIKKQLETIKKRGYDMSLFKEVVDMLLDGKTLPPKYHDHPLRGDKSGYRDCHIQGDWVLIYKIDRGVLTLILSETGTHSDILE*
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
78.9%
Unclassified
7.9%
Kalotermitidae
5.3%
Passalidae
2.6%
Rhinotermitidae
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
104
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 6 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 7 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 8 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_297355 | 3300042656 | Bacteria | 1047 |
| 2 | Ga0466702_462343 | 3300042635 | Unclassified | 1091 |
| 3 | Ga0466712_199064 | 3300042614 | Unclassified | 1415 |
| 4 | Ga0466712_231922 | 3300042614 | Bacteria | 3527 |
| 5 | Ga0466718_001683 | 3300042617 | Bacteria | 3483 |
| 6 | Ga0466718_036431 | 3300042617 | Bacteria | 2415 |
| 7 | Ga0415639_169840 | 3300038395 | Bacteria | 1342 |
| 8 | Ga0466693_156287 | 3300042592 | Bacteria | 2316 |
| 9 | Ga0123355_10140713 | 3300009826 | Bacteria | 3693 |
| 10 | Ga0123355_11100690 | 3300009826 | Bacteria | 826 |
| 11 | Ga0123353_10139383 | 3300010167 | Bacteria | 3887 |
| 12 | Ga0123353_11407939 | 3300010167 | Unclassified | 896 |
| 13 | Ga0123353_12269316 | 3300010167 | Unclassified | 654 |
| 14 | JGI24698J34947_10024536 | 3300002449 | Bacteria | 3220 |
| 15 | JGI24703J35330_11748798 | 3300002501 | Unclassified | 37378 |
| 16 | JGI24699J35502_10715200 | 3300002509 | Bacteria | 781 |
| 17 | Ga0072941_1552164 | 3300005201 | Bacteria | 1093 |
| 18 | Ga0466697_220344 | 3300042611 | Unclassified | 4476 |
| 19 | Ga0466712_235809 | 3300042614 | Bacteria | 1060 |
| 20 | Ga0466718_010160 | 3300042617 | Unclassified | 1826 |
| 21 | Ga0466718_033890 | 3300042617 | Bacteria | 1214 |
| 22 | Ga0466717_265234 | 3300042604 | Bacteria | 1006 |
| 23 | Ga0466721_161591 | 3300042608 | Bacteria | 46073 |
| 24 | Ga0123355_10526306 | 3300009826 | Unclassified | 1443 |
| 25 | Ga0123355_10883022 | 3300009826 | Unclassified | 976 |
| 26 | Ga0123355_10899091 | 3300009826 | Bacteria | 962 |
| 27 | Ga0123356_10401909 | 3300010049 | Unclassified | 1508 |
| 28 | Ga0123353_11484335 | 3300010167 | Bacteria | 865 |
| 29 | AustNasuHG_c1022311 | 3300000089 | Bacteria | 2035 |
| 30 | Ga0072941_1002379 | 3300005201 | Bacteria | 4321 |
| 31 | Ga0466729_253156 | 3300042621 | Bacteria | 1133 |
| 32 | Ga0466712_102208 | 3300042614 | Unclassified | 2791 |
| 33 | Ga0466712_212387 | 3300042614 | Unclassified | 3123 |
| 34 | Ga0466718_138413 | 3300042617 | Bacteria | 2710 |
| 35 | Ga0415639_171921 | 3300038395 | Unclassified | 1379 |
| 36 | Ga0466693_095941 | 3300042592 | Bacteria | 3815 |
| 37 | Ga0466695_373082 | 3300042595 | Unclassified | 1282 |
| 38 | Ga0123357_10191668 | 3300009784 | Bacteria | 2353 |
| 39 | Ga0123355_10541309 | 3300009826 | Bacteria | 1413 |
| 40 | Ga0123355_11183445 | 3300009826 | Unclassified | 783 |
| 41 | Ga0123355_11331493 | 3300009826 | Unclassified | 717 |
| 42 | Ga0123355_11616746 | 3300009826 | Bacteria | 623 |
| 43 | Ga0123356_10225154 | 3300010049 | Bacteria | 1935 |
| 44 | Ga0123356_10747000 | 3300010049 | Bacteria | 1148 |
| 45 | Ga0123356_10860144 | 3300010049 | Bacteria | 1078 |
| 46 | Ga0123353_10412928 | 3300010167 | Bacteria | 2003 |
| 47 | Ga0123353_10532383 | 3300010167 | Bacteria | 1701 |
| 48 | Ga0123353_11129907 | 3300010167 | Unclassified | 1037 |
| 49 | AustNasuHG_c1006403 | 3300000089 | Bacteria | 4203 |
| 50 | AustNasuHG_c1006567 | 3300000089 | Bacteria | 4144 |
| 51 | JGI24698J34947_10159573 | 3300002449 | Unclassified | 925 |
| 52 | JGI24696J40584_12917346 | 3300002834 | Bacteria | 1311 |
| 53 | Ga0466718_005929 | 3300042617 | Bacteria | 4405 |
| 54 | Ga0466718_018515 | 3300042617 | Bacteria | 2406 |
| 55 | Ga0466718_062027 | 3300042617 | Bacteria | 1230 |
| 56 | Ga0466718_167846 | 3300042617 | Bacteria | 2261 |
| 57 | Ga0466714_159413 | 3300042603 | Bacteria | 17985 |
| 58 | Ga0466720_129633 | 3300042607 | Bacteria | 14115 |
| 59 | Ga0264413_125465 | 3300024493 | Bacteria | 1322 |
| 60 | Ga0123353_10048457 | 3300010167 | Bacteria | 6765 |
| 61 | Ga0123353_11800371 | 3300010167 | Unclassified | 761 |
| 62 | Ga0123353_12801315 | 3300010167 | Bacteria | 571 |
| 63 | IMNBL1DRAFT_c0004875 | 3300000062 | Bacteria | 7885 |
| 64 | JGI24698J34947_10041085 | 3300002449 | Bacteria | 2384 |
| 65 | Ga0072941_1001202 | 3300005201 | Bacteria | 5460 |
| 66 | Ga0072941_1062677 | 3300005201 | Bacteria | 1222 |
| 67 | Ga0466731_264020 | 3300042622 | Bacteria | 1145 |
| 68 | Ga0466734_141957 | 3300042623 | Bacteria | 1308 |
| 69 | Ga0466702_300845 | 3300042635 | Bacteria | 1138 |
| 70 | Ga0466703_017573 | 3300042636 | Bacteria | 1911 |
| 71 | Ga0466729_182134 | 3300042621 | Bacteria | 1653 |
| 72 | Ga0466698_517226 | 3300042610 | Bacteria | 1043 |
| 73 | Ga0415639_162273 | 3300038395 | Bacteria | 1136 |
| 74 | Ga0466699_431401 | 3300042597 | Bacteria | 1482 |
| 75 | Ga0123357_10886541 | 3300009784 | Bacteria | 580 |
| 76 | Ga0123355_10586304 | 3300009826 | Unclassified | 1330 |
| 77 | Ga0123356_10080236 | 3300010049 | Bacteria | 3085 |
| 78 | JGI24698J34947_10041138 | 3300002449 | Bacteria | 2382 |
| 79 | JGI24695J34938_10420504 | 3300002450 | Unclassified | 599 |
| 80 | Ga0466702_416922 | 3300042635 | Bacteria | 1166 |
| 81 | Ga0466712_156845 | 3300042614 | Bacteria | 7192 |
| 82 | Ga0466715_125105 | 3300042616 | Bacteria | 1603 |
| 83 | Ga0466718_039770 | 3300042617 | Bacteria | 1906 |
| 84 | Ga0466718_104790 | 3300042617 | Bacteria | 1212 |
| 85 | Ga0466706_146448 | 3300042599 | Bacteria | 2983 |
| 86 | Ga0466717_186763 | 3300042604 | Bacteria | 2843 |
| 87 | Ga0466717_254326 | 3300042604 | Bacteria | 1879 |
| 88 | Ga0466721_392057 | 3300042608 | Bacteria | 1128 |
| 89 | Ga0415639_057735 | 3300038395 | Archaea | 2203 |
| 90 | Ga0466693_196703 | 3300042592 | Bacteria | 1464 |
| 91 | Ga0466693_364785 | 3300042592 | Unclassified | 4879 |
| 92 | Ga0466694_184422 | 3300042594 | Bacteria | 2786 |
| 93 | Ga0123355_10067854 | 3300009826 | Bacteria | 5738 |
| 94 | Ga0123355_10436222 | 3300009826 | Bacteria | 1662 |
| 95 | Ga0123355_10561306 | 3300009826 | Unclassified | 1375 |
| 96 | Ga0123356_12667303 | 3300010049 | Bacteria | 626 |
| 97 | Ga0123353_10164530 | 3300010167 | Bacteria | 3528 |
| 98 | IMNBL1DRAFT_c0002406 | 3300000062 | Bacteria | 13027 |
| 99 | JGI24698J34947_10123048 | 3300002449 | Bacteria | 1122 |
| 100 | JGI24695J34938_10126884 | 3300002450 | Bacteria | 1039 |
| 101 | Ga0072940_1003206 | 3300005200 | Bacteria | 13127 |
| 102 | Ga0072941_1390850 | 3300005201 | Unclassified | 3775 |
| 103 | Ga0466702_452320 | 3300042635 | Bacteria | 12267 |
| 104 | Ga0466712_173204 | 3300042614 | Bacteria | 1405 |
| 105 | Ga0466718_081946 | 3300042617 | Bacteria | 1732 |
| 106 | Ga0466718_101316 | 3300042617 | Bacteria | 5517 |
| 107 | Ga0466718_156174 | 3300042617 | Bacteria | 6175 |
| 108 | Ga0123355_10010767 | 3300009826 | Bacteria | 14056 |
| 109 | Ga0123355_10932789 | 3300009826 | Bacteria | 936 |
| 110 | Ga0123356_10166958 | 3300010049 | Bacteria | 2206 |
| 111 | Ga0123353_10272106 | 3300010167 | Bacteria | 2609 |
| 112 | JGI24698J34947_10025955 | 3300002449 | Bacteria | 3115 |
| 113 | JGI24698J34947_10313828 | 3300002449 | Unclassified | 560 |
| 114 | JGI24695J34938_10017454 | 3300002450 | Unclassified | 3615 |
| 115 | JGI24695J34938_10050376 | 3300002450 | Bacteria | 1827 |
| 116 | Ga0072940_1003205 | 3300005200 | Bacteria | 2625 |
| 117 | Ga0466733_023856 | 3300042659 | Unclassified | 6311 |
| 118 | Ga0466733_066831 | 3300042659 | Bacteria | 3812 |
| 119 | Ga0466731_055428 | 3300042622 | Unclassified | 1079 |
| 120 | Ga0466702_211055 | 3300042635 | Bacteria | 1678 |
| 121 | Ga0466718_103489 | 3300042617 | Bacteria | 2046 |
| 122 | Ga0466720_040658 | 3300042607 | Bacteria | 1797 |
| 123 | Ga0264413_116651 | 3300024493 | Bacteria | 1008 |
| 124 | Ga0415639_162272 | 3300038395 | Unclassified | 1435 |
| 125 | Ga0466693_187110 | 3300042592 | Unclassified | 1383 |
| 126 | Ga0123355_10531421 | 3300009826 | Unclassified | 1433 |
| 127 | Ga0123355_10815808 | 3300009826 | Bacteria | 1036 |
| 128 | AustNasuHG_c1045558 | 3300000089 | Bacteria | 1001 |
| 129 | JGI24698J34947_10013022 | 3300002449 | Bacteria | 4544 |
| 130 | JGI24698J34947_10239662 | 3300002449 | Bacteria | 684 |
| 131 | JGI24695J34938_10100651 | 3300002450 | Bacteria | 1181 |
| 132 | JGI24705J35276_12005060 | 3300002504 | Bacteria | 853 |
| 133 | JGI24699J35502_11035790 | 3300002509 | Bacteria | 1540 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF15738 | YafQ_toxin | Bacterial toxin of type II toxin-antitoxin system, YafQ | 9 | 97 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.