Protein Family IF01375

Metagenome Isolate
166 Members
96 Samples
128 Scaffolds
365.68 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1365953|Ga0072941_13659531
Length
418 aa
Sequence
MAVMQSFSIIPPGESGITLKIERIFPEANTSGPKNANLAGFLSAGVRWRPISVAQRPDRDFSIEDLLLMVILKSQRDALLSPLQSVSGIVERRHTLPILSNVLLEKRDDTLTLIATDVTVAARKLQDILRSLPDTAPVTLDLDEKRLLVRAGKSRFTLQTLPADDFPRMAITEGAHKTLKVTQREFRTLIGKTQYAMAAQDVRYYLNGLMLMVDGPELRSVATXGHRLAYNSMAISADLERQEMILPRKTVLELNRLLSDSDDSLEITLGANQIRFAFGDIVLVSKLIDGKFPDYERVIPGELTHHMTVHRQALHSAMSRAAILTNDKFHGVRVILGENTLKIIAANAEQEEAEEEIEVQYTGVPLDIGFNVTYLLDVLNNLAGDTVVWSFNDANSSALITMPDNDRFKYVVMPMRI*

📊 Sample Types

Isolate 22.9%
Metagenome 77.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.1%
Termitidae 16.3%
Kalotermitidae 15.2%
Formicidae 12.0%
Ixodidae 5.4%
Argasidae 4.3%
Apidae 3.3%
Drosophilidae 3.3%
Rhinotermitidae 3.3%
Termopsidae 3.3%
Passalidae 2.2%
Culicidae 2.2%
Gryllidae 1.1%
Hodotermitidae 1.1%
Alydidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2506210010 Francisella tularensis tularensis FSC041 Isolate
2 2506210015 Francisella tularensis holarctica FSC185 Isolate
3 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
4 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
5 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
6 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
7 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
8 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 637000113 Francisella tularensis tularensis FSC 198 Isolate
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
18 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
19 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
20 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
21 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
22 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
23 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
24 2871595141 Francisella tularensis 503 Isolate Ixodidae
25 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
26 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
38 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
39 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
40 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
41 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 2603880172 Burkholderiales C Isolate Unclassified
44 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
45 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
46 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
53 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
54 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
55 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
56 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
57 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
58 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
59 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
60 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
63 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
64 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
65 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
68 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
69 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
70 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
71 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
72 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
73 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
74 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
75 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
76 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
77 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
78 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
79 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
80 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
83 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
84 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
85 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
86 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
87 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
88 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
89 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
90 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
91 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
92 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
93 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
94 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
95 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
96 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10000044 3300010882 Bacteria 93974
2 Ga0466722_019062 3300042609 Bacteria 26115
3 CVPL010W_10001199 3300002931 Bacteria 37871
4 Ga0104050_1000859 3300007153 Bacteria 4944
5 Ga0103264_1001113 3300007188 Bacteria 11998
6 Ga0103264_1006536 3300007188 Bacteria 5600
7 Ga0466715_033333 3300042616 Bacteria 10550
8 Ga0466723_186104 3300042618 Bacteria 14358
9 Ga0466708_264321 3300042652 Bacteria 36169
10 Ga0160472_100187 3300012839 Bacteria 80370
11 Ga0466696_092686 3300042596 Bacteria 6001
12 Ga0466701_007049 3300042598 Bacteria 22470
13 Ga0466707_175120 3300042601 Bacteria 20435
14 Ga0466719_263560 3300042606 Bacteria 7051
15 IMNBL1DRAFT_c0002865 3300000062 Bacteria 11567
16 Ga0074278_114570 3300005721 Bacteria 27768
17 Ga0103261_1001266 3300007083 Bacteria 4034
18 Ga0102740_1000253 3300007140 Bacteria 55288
19 Ga0103264_1001792 3300007188 Bacteria 22626
20 Ga0123357_10000155 3300009784 Bacteria 61105
21 Ga0466712_055531 3300042614 Bacteria 4424
22 Ga0466711_259947 3300042615 Bacteria 12551
23 Ga0466729_084932 3300042621 Bacteria 104590
24 Ga0466734_111112 3300042623 Bacteria 27338
25 Ga0466708_181947 3300042652 Bacteria 11987
26 Ga0466725_035713 3300042654 Bacteria 27389
27 Ga0123356_10014197 3300010049 Unclassified 7662
28 Ga0466701_090907 3300042598 Bacteria 9317
29 Ga0466717_235491 3300042604 Bacteria 3197
30 Ga0466719_096451 3300042606 Bacteria 7786
31 JGI24698J34947_10079805 3300002449 Bacteria 1539
32 CVPL010W_10007015 3300002931 Bacteria 11282
33 Ga0072941_1002103 3300005201 Bacteria 4399
34 Ga0102740_1000832 3300007140 Bacteria 8374
35 Ga0102737_1000815 3300007142 Unclassified 9629
36 Ga0466710_361075 3300042613 Bacteria 2490
37 Ga0466705_191533 3300042612 Unclassified 1630
38 Ga0466735_213396 3300042624 Bacteria 4128
39 Ga0466709_058772 3300042648 Bacteria 3117
40 Ga0466657_212213 3300042582 Bacteria 50857
41 Ga0466690_339922 3300042590 Bacteria 10336
42 Ga0466691_212251 3300042593 Bacteria 12208
43 Ga0466695_281258 3300042595 Bacteria 5503
44 Ga0466719_070793 3300042606 Bacteria 4984
45 JGI24702J35022_10001591 3300002462 Bacteria 14048
46 Ga0103266_1006274 3300007067 Bacteria 1504
47 Ga0466705_403146 3300042612 Bacteria 4561
48 Ga0466711_504254 3300042615 Bacteria 36018
49 Ga0466715_143205 3300042616 Bacteria 113538
50 Ga0466723_361554 3300042618 Bacteria 3686
51 Ga0466726_105855 3300042619 Bacteria 3940
52 Ga0466729_191972 3300042621 Bacteria 13642
53 Ga0466703_042381 3300042636 Bacteria 10524
54 Ga0466724_18188 3300042649 Bacteria 4343
55 Ga0466708_126712 3300042652 Unclassified 2936
56 Ga0466708_359657 3300042652 Bacteria 31241
57 Ga0160460_102993 3300012845 Unclassified 3274
58 Ga0466692_032953 3300042591 Bacteria 10700
59 Ga0466691_216509 3300042593 Bacteria 4242
60 Ga0123356_10174098 3300010049 Bacteria 2166
61 Ga0123354_10000178 3300010882 Bacteria 53052
62 Ga0466716_221773 3300042605 Bacteria 38218
63 Ga0466719_226570 3300042606 Bacteria 8878
64 HBC_ctgsDRAFT_1000082 3300000333 Bacteria 24348
65 Ga0072941_1365953 3300005201 Bacteria 1797
66 Ga0102736_1000454 3300007052 Bacteria 21362
67 Ga0102736_1005510 3300007052 Unclassified 1614
68 Ga0103260_1004207 3300007139 Unclassified 2220
69 Ga0102737_1001345 3300007142 Unclassified 6936
70 Ga0104040_1042772 3300007149 Unclassified 1389
71 Ga0123357_10000050 3300009784 Bacteria 93540
72 Ga0466710_254923 3300042613 Bacteria 4891
73 Ga0466715_227407 3300042616 Bacteria 5453
74 Ga0466726_109562 3300042619 Bacteria 11213
75 Ga0466704_360892 3300042643 Bacteria 6186
76 Ga0466709_131011 3300042648 Bacteria 4830
77 Ga0466708_379955 3300042652 Bacteria 9249
78 Ga0466657_117791 3300042582 Bacteria 208686
79 Ga0466706_015935 3300042599 Bacteria 13682
80 Ga0466713_052916 3300042602 Bacteria 3767
81 Ga0466719_020545 3300042606 Bacteria 13069
82 CVPL005W_1000459 3300002934 Bacteria 36337
83 CVPL005W_1000524 3300002934 Bacteria 22151
84 CVPL005L_10000019 3300002938 Bacteria 97133
85 Ga0102738_1003066 3300007141 Unclassified 2465
86 Ga0102737_1001098 3300007142 Bacteria 7923
87 Ga0103264_1001150 3300007188 Bacteria 11755
88 Ga0466710_229986 3300042613 Bacteria 101001
89 Ga0466715_113616 3300042616 Bacteria 16248
90 Ga0466705_009003 3300042612 Bacteria 28618
91 Ga0466704_254151 3300042643 Bacteria 8695
92 Ga0466704_457140 3300042643 Bacteria 2164
93 Ga0466708_129698 3300042652 Bacteria 22151
94 Ga0466725_074889 3300042654 Bacteria 25778
95 Ga0466727_225331 3300042655 Bacteria 8130
96 Ga0466657_209042 3300042582 Bacteria 4557
97 Ga0466692_053225 3300042591 Bacteria 32811
98 Ga0466706_282413 3300042599 Bacteria 6525
99 Ga0466707_054320 3300042601 Bacteria 54616
100 Ga0466707_367869 3300042601 Bacteria 1718
101 Ga0466717_111275 3300042604 Bacteria 2067
102 Ga0466722_112339 3300042609 Bacteria 3789
103 CVPL010W_10011167 3300002931 Bacteria 7550
104 Ga0072941_1002102 3300005201 Bacteria 12676
105 Ga0103266_1000318 3300007067 Bacteria 19255
106 Ga0466715_343602 3300042616 Bacteria 1781
107 Ga0466728_292145 3300042620 Bacteria 10451
108 Ga0466729_263890 3300042621 Unclassified 4230
109 Ga0466735_092715 3300042624 Bacteria 4096
110 Ga0466703_259944 3300042636 Bacteria 27101
111 Ga0466704_440395 3300042643 Bacteria 4766
112 Ga0466704_441627 3300042643 Bacteria 13322
113 Ga0466725_185922 3300042654 Bacteria 18138
114 Ga0466692_142523 3300042591 Bacteria 9997
115 Ga0466719_026538 3300042606 Bacteria 1289
116 Ga0466722_113168 3300042609 Bacteria 4253
117 Ga0466722_128749 3300042609 Bacteria 4571
118 2227546574 2225789004 Bacteria 2911
119 Ga0074306_1020492 3300005309 Bacteria 2719
120 Ga0466711_224167 3300042615 Bacteria 2951
121 Ga0466726_082639 3300042619 Bacteria 2281
122 Ga0466729_011795 3300042621 Unclassified 4966
123 Ga0466734_129726 3300042623 Bacteria 1570
124 Ga0466702_034958 3300042635 Bacteria 3418
125 Ga0466708_215602 3300042652 Bacteria 15739
126 Ga0466725_093902 3300042654 Bacteria 73980
127 Ga0466691_000707 3300042593 Bacteria 9801
128 Ga0466701_014755 3300042598 Bacteria 5785

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain 297 416 0.99
PF02767 DNA_pol3_beta_2 DNA polymerase III beta subunit, central domain 181 294 0.98
PF00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain 118 169 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.