Protein Family IF01367
Metagenome
Isolate
610
Members
261
Samples
424
Scaffolds
450.04
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1227244|Ga0072941_12272443
- Length
- 499 aa
- Sequence
- MFTTGEILETIKMIREEHLDIRTITMGISLLDCADGDAAAACQRIYDKISRLGENLVQVSVDIERQYGIPIINKRVAVTPVSVVAGASGAADYTCYARALNKAAENIGVNFIGGFSALVHKGYTDGDRKLIMSIPSALGETELVCSSVNVASAKAGINMDAVREMGEIILQTAELTKDRDCVGCAKLVVFANAPEDNPFMAGAFHGTGEAESCLNVGVSGPGVIKAALENLGGAAFDELADAIKFMAGAFHGVGEGDSVINVGVSGPGVVKSALEQARGEDFGVVAETIKRTAFKITRVGQLVAHEAAKRLDVPFGIVDLSLAPTPTVGDSVAHILEEMGLEICGAHGTTAALALLNDSVKKGGVMAAGYVGGLSGAFIPVSEDAGMIDAVKRGALTLDKLEAMTSVCSVGLDMVAIPGDCTPALISAIIADEMAVGVVNNKTTAVRVIPAIGKREGDCLEFGGLLGKAPVMAVNRYDSSAFIQRGGRIPAPLHSLRN*
Sample Types
Isolate
30.5%
Metagenome
69.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.2%
Blattidae
15.8%
Termitidae
14.2%
Drosophilidae
9.3%
Apidae
8.1%
Kalotermitidae
6.5%
Tenebrionidae
3.2%
Scarabaeidae
2.0%
Rhinotermitidae
1.6%
Termopsidae
1.6%
Passalidae
1.2%
Penaeidae
0.4%
Libellulidae
0.4%
Ixodidae
0.4%
Vespidae
0.4%
Hodotermitidae
0.4%
Gomphidae
0.4%
Formicidae
0.4%
Armadillidiidae
0.4%
Taxonomy
Archaea
36
Bacteria
537
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 2 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 3 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 4 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 5 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 6 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 7 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 8 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 9 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 10 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 11 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 12 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 13 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 14 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 15 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 16 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 17 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 18 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 19 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 20 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 21 | 2820610792 | Unclassified Firmicutes Emb289P1bin33 | Isolate | Unclassified |
| 22 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 23 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 26 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 27 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 28 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 29 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 30 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 31 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 32 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 33 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 34 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 35 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 36 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 37 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 38 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 39 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 40 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 41 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 42 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 50 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 51 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 52 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 53 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 54 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 55 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 56 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 57 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 58 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 59 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 60 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 61 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 62 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 63 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 64 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 65 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 66 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 67 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 68 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 69 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 70 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 71 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 72 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 73 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 74 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 75 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 76 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 77 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 78 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 79 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 80 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 81 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 82 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 83 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 84 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 85 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 86 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 87 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 88 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 89 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 90 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 91 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 92 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 93 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 94 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 95 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 96 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 97 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 98 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 99 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 100 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 101 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 102 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 103 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 104 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 105 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 106 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 107 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 108 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 109 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 110 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 111 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 112 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 113 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 114 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 115 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 116 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 117 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 118 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 119 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 120 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 121 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 122 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 123 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 124 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 125 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 126 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 127 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 128 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 129 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 130 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 131 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 132 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 133 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 134 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 135 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 136 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 137 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 138 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 139 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 140 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 141 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 142 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 143 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 144 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 145 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 146 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 147 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 148 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 149 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 150 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 151 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 152 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 153 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 154 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 155 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 156 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 157 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 158 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 159 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 160 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 161 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 162 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 163 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 164 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 165 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 166 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 167 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 168 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 169 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 170 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 171 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 172 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 173 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 174 | 2773857678 | Unclassified Methanomassiliicoccaceae Co191P4bin17 | Isolate | Unclassified |
| 175 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 176 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 177 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 178 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 179 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 180 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 181 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 182 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 183 | 2608642196 | Candidatus Methanoplasma termitum MpT1 | Isolate | Unclassified |
| 184 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 185 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 186 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 187 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 188 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 189 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 190 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 191 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 192 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 193 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 194 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 195 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 196 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 197 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 198 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 199 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 200 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 201 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 202 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 203 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 204 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 205 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 206 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 207 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 208 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 209 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 210 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 211 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 212 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 213 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 214 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 215 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 216 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 217 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 218 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 219 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 220 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 221 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 222 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 223 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 224 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 225 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 226 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 227 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 228 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 229 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 230 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 231 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 232 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 233 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 234 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 235 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 236 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 237 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 238 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 239 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 240 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 241 | 2773857677 | Methanoplasma sp. Cu122P5bin30 | Isolate | Unclassified |
| 242 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 243 | 2773857691 | Unclassified Methanomassiliicoccaceae Nt197P4bin4 | Isolate | Unclassified |
| 244 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 245 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 246 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 247 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 248 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 249 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 250 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 251 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 252 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 253 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 254 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 255 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 256 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 257 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 258 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 259 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 260 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 261 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_454791 | 3300042656 | Bacteria | 2503 |
| 2 | Ga0466733_159411 | 3300042659 | Bacteria | 5170 |
| 3 | Ga0466733_181202 | 3300042659 | Bacteria | 1941 |
| 4 | Ga0466733_218900 | 3300042659 | Bacteria | 20801 |
| 5 | Ga0562379_0014 | 3300056790 | Bacteria | 1325122 |
| 6 | Ga0562379_4266 | 3300056790 | Unclassified | 7614 |
| 7 | Ga0562377_0503 | 3300056842 | Unclassified | 62361 |
| 8 | Ga0562374_0037 | 3300057007 | Bacteria | 679104 |
| 9 | Ga0466692_026254 | 3300042591 | Bacteria | 97091 |
| 10 | Ga0466692_183184 | 3300042591 | Archaea | 95163 |
| 11 | Ga0466691_000905 | 3300042593 | Bacteria | 1630 |
| 12 | Ga0466706_242986 | 3300042599 | Bacteria | 3287 |
| 13 | Ga0466706_286393 | 3300042599 | Unclassified | 7107 |
| 14 | Ga0466707_082805 | 3300042601 | Bacteria | 61537 |
| 15 | Ga0466707_298841 | 3300042601 | Bacteria | 23255 |
| 16 | Ga0466714_078529 | 3300042603 | Bacteria | 17715 |
| 17 | Ga0466714_125218 | 3300042603 | Bacteria | 1756 |
| 18 | Ga0466719_303954 | 3300042606 | Bacteria | 16248 |
| 19 | Ga0466719_444203 | 3300042606 | Bacteria | 3168 |
| 20 | Ga0466722_222115 | 3300042609 | Bacteria | 2601 |
| 21 | Ga0466722_224491 | 3300042609 | Bacteria | 8222 |
| 22 | Ga0466698_157547 | 3300042610 | Bacteria | 23432 |
| 23 | Ga0123357_10005015 | 3300009784 | Archaea | 15743 |
| 24 | Ga0123355_10009422 | 3300009826 | Bacteria | 14842 |
| 25 | Ga0123355_10053073 | 3300009826 | Bacteria | 6574 |
| 26 | Ga0123353_10001088 | 3300010167 | Bacteria | 33055 |
| 27 | Ga0123353_10001626 | 3300010167 | Bacteria | 27644 |
| 28 | Ga0123353_10276592 | 3300010167 | Bacteria | 2582 |
| 29 | Ga0123353_10312480 | 3300010167 | Bacteria | 2390 |
| 30 | IMNBL1DRAFT_c0000727 | 3300000062 | Bacteria | 26139 |
| 31 | IMNBL1DRAFT_c0007375 | 3300000062 | Unclassified | 5803 |
| 32 | JGI24702J35022_10075831 | 3300002462 | Bacteria | 1817 |
| 33 | JGI24696J40584_12955228 | 3300002834 | Unclassified | 2790 |
| 34 | JGI24696J40584_12960928 | 3300002834 | Archaea | 9393 |
| 35 | Ga0104019_1012383 | 3300007150 | Unclassified | 2799 |
| 36 | Ga0466704_311459 | 3300042643 | Bacteria | 5309 |
| 37 | Ga0466708_296370 | 3300042652 | Bacteria | 24473 |
| 38 | Ga0466725_350550 | 3300042654 | Archaea | 3329 |
| 39 | Ga0466711_324726 | 3300042615 | Bacteria | 9045 |
| 40 | Ga0466715_426309 | 3300042616 | Bacteria | 20188 |
| 41 | Ga0466718_070713 | 3300042617 | Bacteria | 1928 |
| 42 | Ga0466723_144907 | 3300042618 | Bacteria | 2149 |
| 43 | Ga0466723_304728 | 3300042618 | Bacteria | 22888 |
| 44 | Ga0466726_225654 | 3300042619 | Bacteria | 28119 |
| 45 | Ga0466726_391803 | 3300042619 | Bacteria | 1941 |
| 46 | Ga0466726_460416 | 3300042619 | Bacteria | 3605 |
| 47 | Ga0466728_184851 | 3300042620 | Bacteria | 6282 |
| 48 | Ga0466728_196573 | 3300042620 | Bacteria | 11789 |
| 49 | Ga0466728_474298 | 3300042620 | Bacteria | 45956 |
| 50 | Ga0466705_290711 | 3300042612 | Bacteria | 51058 |
| 51 | Ga0466733_197136 | 3300042659 | Bacteria | 4519 |
| 52 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 53 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 54 | Ga0562375_0222 | 3300056856 | Bacteria | 157401 |
| 55 | Ga0415639_132042 | 3300038395 | Bacteria | 4054 |
| 56 | Ga0466690_023393 | 3300042590 | Bacteria | 35960 |
| 57 | Ga0466691_172295 | 3300042593 | Bacteria | 25336 |
| 58 | Ga0466694_081220 | 3300042594 | Bacteria | 5025 |
| 59 | Ga0466696_361752 | 3300042596 | Bacteria | 12877 |
| 60 | Ga0466699_379695 | 3300042597 | Unclassified | 2007 |
| 61 | Ga0466706_012138 | 3300042599 | Bacteria | 8396 |
| 62 | Ga0466706_150590 | 3300042599 | Bacteria | 23105 |
| 63 | Ga0466707_137784 | 3300042601 | Bacteria | 8676 |
| 64 | Ga0466707_406084 | 3300042601 | Archaea | 41531 |
| 65 | Ga0466713_133432 | 3300042602 | Bacteria | 1350 |
| 66 | Ga0123353_10004743 | 3300010167 | Archaea | 17617 |
| 67 | Ga0123353_10006043 | 3300010167 | Bacteria | 16042 |
| 68 | Ga0123353_10087257 | 3300010167 | Bacteria | 5026 |
| 69 | Ga0123354_10064668 | 3300010882 | Archaea | 5362 |
| 70 | IMNBL1DRAFT_c0000466 | 3300000062 | Bacteria | 33823 |
| 71 | AustNasuHG_c1014205 | 3300000089 | Bacteria | 2713 |
| 72 | JGI24705J35276_12235943 | 3300002504 | Bacteria | 7200 |
| 73 | JGI24696J40584_12958200 | 3300002834 | Bacteria | 3958 |
| 74 | Ga0074188_1157009 | 3300005318 | Bacteria | 1527 |
| 75 | Ga0466729_245568 | 3300042621 | Bacteria | 14091 |
| 76 | Ga0466734_063023 | 3300042623 | Bacteria | 4132 |
| 77 | Ga0466735_050281 | 3300042624 | Bacteria | 2656 |
| 78 | Ga0466703_048545 | 3300042636 | Unclassified | 11522 |
| 79 | Ga0466703_169540 | 3300042636 | Bacteria | 10929 |
| 80 | Ga0466704_264022 | 3300042643 | Bacteria | 11552 |
| 81 | Ga0466704_383154 | 3300042643 | Bacteria | 3162 |
| 82 | Ga0466704_450558 | 3300042643 | Bacteria | 1666 |
| 83 | Ga0466704_591581 | 3300042643 | Bacteria | 13422 |
| 84 | Ga0466710_065191 | 3300042613 | Archaea | 8662 |
| 85 | Ga0466711_009139 | 3300042615 | Bacteria | 3995 |
| 86 | Ga0466711_333736 | 3300042615 | Bacteria | 27766 |
| 87 | Ga0466711_471566 | 3300042615 | Bacteria | 7645 |
| 88 | Ga0466715_057230 | 3300042616 | Bacteria | 3226 |
| 89 | Ga0466715_139514 | 3300042616 | Bacteria | 11548 |
| 90 | Ga0466715_405714 | 3300042616 | Bacteria | 15310 |
| 91 | Ga0466715_426496 | 3300042616 | Bacteria | 16993 |
| 92 | Ga0466718_110977 | 3300042617 | Bacteria | 6055 |
| 93 | Ga0466723_020458 | 3300042618 | Bacteria | 3452 |
| 94 | Ga0466726_142046 | 3300042619 | Bacteria | 40896 |
| 95 | Ga0466728_310083 | 3300042620 | Bacteria | 4084 |
| 96 | Ga0466705_140779 | 3300042612 | Bacteria | 12584 |
| 97 | Ga0562379_3314 | 3300056790 | Bacteria | 10940 |
| 98 | Ga0562374_0192 | 3300057007 | Unclassified | 131760 |
| 99 | Ga0415639_006749 | 3300038395 | Bacteria | 6118 |
| 100 | Ga0415639_036085 | 3300038395 | Bacteria | 3459 |
| 101 | Ga0466693_274565 | 3300042592 | Bacteria | 2396 |
| 102 | Ga0466691_080093 | 3300042593 | Bacteria | 7193 |
| 103 | Ga0466696_056996 | 3300042596 | Bacteria | 4473 |
| 104 | Ga0466696_292932 | 3300042596 | Bacteria | 3309 |
| 105 | Ga0466696_352331 | 3300042596 | Bacteria | 9193 |
| 106 | Ga0466706_024196 | 3300042599 | Bacteria | 58679 |
| 107 | Ga0466706_032983 | 3300042599 | Bacteria | 10373 |
| 108 | Ga0466706_054063 | 3300042599 | Bacteria | 1990 |
| 109 | Ga0466706_126291 | 3300042599 | Unclassified | 1688 |
| 110 | Ga0466706_150166 | 3300042599 | Bacteria | 10114 |
| 111 | Ga0466706_154904 | 3300042599 | Bacteria | 77574 |
| 112 | Ga0466706_238327 | 3300042599 | Bacteria | 15685 |
| 113 | Ga0466706_273314 | 3300042599 | Bacteria | 10565 |
| 114 | Ga0466700_423634 | 3300042600 | Bacteria | 1845 |
| 115 | Ga0466707_369469 | 3300042601 | Bacteria | 1786 |
| 116 | Ga0466713_115831 | 3300042602 | Bacteria | 11256 |
| 117 | Ga0466714_054417 | 3300042603 | Bacteria | 2059 |
| 118 | Ga0466717_050288 | 3300042604 | Bacteria | 3469 |
| 119 | Ga0466719_171152 | 3300042606 | Bacteria | 3041 |
| 120 | Ga0466722_047899 | 3300042609 | Bacteria | 99541 |
| 121 | Ga0123355_10024720 | 3300009826 | Unclassified | 9658 |
| 122 | Ga0123353_10018069 | 3300010167 | Bacteria | 10406 |
| 123 | Ga0123353_10054450 | 3300010167 | Bacteria | 6397 |
| 124 | Ga0123353_10102381 | 3300010167 | Bacteria | 4615 |
| 125 | Ga0123353_10464747 | 3300010167 | Bacteria | 1858 |
| 126 | 2227080774 | 2225789004 | Bacteria | 191256 |
| 127 | 2227358563 | 2225789004 | Bacteria | 106790 |
| 128 | IMNBL1DRAFT_c0003453 | 3300000062 | Archaea | 10152 |
| 129 | IMNBL1DRAFT_c0014419 | 3300000062 | Archaea | 3489 |
| 130 | JGI24695J34938_10012746 | 3300002450 | Bacteria | 4444 |
| 131 | Ga0074278_123286 | 3300005721 | Bacteria | 6464 |
| 132 | Ga0466702_112032 | 3300042635 | Bacteria | 49240 |
| 133 | Ga0466702_263133 | 3300042635 | Bacteria | 5187 |
| 134 | Ga0466703_286295 | 3300042636 | Bacteria | 8952 |
| 135 | Ga0466704_215946 | 3300042643 | Bacteria | 4417 |
| 136 | Ga0466709_077102 | 3300042648 | Bacteria | 85274 |
| 137 | Ga0466708_180524 | 3300042652 | Bacteria | 5353 |
| 138 | Ga0466725_022961 | 3300042654 | Bacteria | 80127 |
| 139 | Ga0466727_235044 | 3300042655 | Bacteria | 83297 |
| 140 | Ga0466710_239199 | 3300042613 | Bacteria | 10356 |
| 141 | Ga0466711_013831 | 3300042615 | Bacteria | 3712 |
| 142 | Ga0466711_043018 | 3300042615 | Bacteria | 27246 |
| 143 | Ga0466711_140382 | 3300042615 | Bacteria | 2307 |
| 144 | Ga0466711_227429 | 3300042615 | Bacteria | 25883 |
| 145 | Ga0466715_022043 | 3300042616 | Bacteria | 4368 |
| 146 | Ga0466715_060395 | 3300042616 | Bacteria | 60120 |
| 147 | Ga0466715_222215 | 3300042616 | Bacteria | 57057 |
| 148 | Ga0466715_308318 | 3300042616 | Bacteria | 2061 |
| 149 | Ga0466715_393535 | 3300042616 | Bacteria | 17053 |
| 150 | Ga0466715_449364 | 3300042616 | Bacteria | 5714 |
| 151 | Ga0466715_523395 | 3300042616 | Bacteria | 14426 |
| 152 | Ga0466718_088234 | 3300042617 | Bacteria | 1738 |
| 153 | Ga0466723_374210 | 3300042618 | Bacteria | 1637 |
| 154 | Ga0466726_008874 | 3300042619 | Bacteria | 15690 |
| 155 | Ga0466726_024087 | 3300042619 | Archaea | 30343 |
| 156 | Ga0466728_266022 | 3300042620 | Bacteria | 23235 |
| 157 | Ga0466728_481694 | 3300042620 | Bacteria | 39138 |
| 158 | Ga0466729_077963 | 3300042621 | Bacteria | 3042 |
| 159 | Ga0466705_042750 | 3300042612 | Bacteria | 5414 |
| 160 | Ga0562379_1430 | 3300056790 | Bacteria | 27337 |
| 161 | Ga0562377_0330 | 3300056842 | Bacteria | 94287 |
| 162 | Ga0466706_011186 | 3300042599 | Bacteria | 7061 |
| 163 | Ga0466706_013298 | 3300042599 | Bacteria | 114044 |
| 164 | Ga0466706_022287 | 3300042599 | Bacteria | 38904 |
| 165 | Ga0466706_038765 | 3300042599 | Bacteria | 36318 |
| 166 | Ga0466706_071336 | 3300042599 | Bacteria | 35955 |
| 167 | Ga0466706_227190 | 3300042599 | Bacteria | 2596 |
| 168 | Ga0466706_283927 | 3300042599 | Bacteria | 5518 |
| 169 | Ga0466700_426723 | 3300042600 | Archaea | 5694 |
| 170 | Ga0466707_004238 | 3300042601 | Bacteria | 11502 |
| 171 | Ga0466707_317273 | 3300042601 | Bacteria | 27962 |
| 172 | Ga0466713_032120 | 3300042602 | Bacteria | 34196 |
| 173 | Ga0466713_120286 | 3300042602 | Bacteria | 5972 |
| 174 | Ga0466716_227472 | 3300042605 | Bacteria | 1708 |
| 175 | Ga0466716_464161 | 3300042605 | Bacteria | 2172 |
| 176 | Ga0466719_353167 | 3300042606 | Bacteria | 93798 |
| 177 | Ga0466722_161668 | 3300042609 | Bacteria | 4109 |
| 178 | Ga0123357_10074597 | 3300009784 | Unclassified | 4487 |
| 179 | Ga0123355_10117707 | 3300009826 | Bacteria | 4130 |
| 180 | Ga0123353_10129755 | 3300010167 | Bacteria | 4047 |
| 181 | Ga0123353_10356502 | 3300010167 | Bacteria | 2201 |
| 182 | Ga0123354_10015472 | 3300010882 | Bacteria | 11914 |
| 183 | Ga0123354_10111088 | 3300010882 | Bacteria | 3619 |
| 184 | 2226980350 | 2225789003 | Archaea | 96537 |
| 185 | 2227441893 | 2225789004 | Archaea | 26176 |
| 186 | IMNBL1DRAFT_c0000066 | 3300000062 | Bacteria | 95639 |
| 187 | IMNBL1DRAFT_c0006911 | 3300000062 | Archaea | 6083 |
| 188 | HBC_ctgsDRAFT_1000188 | 3300000333 | Bacteria | 14675 |
| 189 | JGI24702J35022_10000184 | 3300002462 | Bacteria | 33395 |
| 190 | JGI24702J35022_10001008 | 3300002462 | Bacteria | 17647 |
| 191 | JGI24702J35022_10033095 | 3300002462 | Bacteria | 2766 |
| 192 | CVPL010L_1001104 | 3300002932 | Unclassified | 13187 |
| 193 | Ga0068302_10021411 | 3300005071 | Bacteria | 10763 |
| 194 | Ga0068305_10003993 | 3300005083 | Bacteria | 109457 |
| 195 | Ga0466703_401130 | 3300042636 | Bacteria | 2360 |
| 196 | Ga0466704_048663 | 3300042643 | Bacteria | 21786 |
| 197 | Ga0466704_476262 | 3300042643 | Bacteria | 3092 |
| 198 | Ga0466709_078814 | 3300042648 | Bacteria | 161286 |
| 199 | Ga0466708_012805 | 3300042652 | Bacteria | 61098 |
| 200 | Ga0466725_200156 | 3300042654 | Bacteria | 48360 |
| 201 | Ga0466715_474214 | 3300042616 | Bacteria | 4446 |
| 202 | Ga0466715_569640 | 3300042616 | Bacteria | 51637 |
| 203 | Ga0466723_142226 | 3300042618 | Bacteria | 12794 |
| 204 | Ga0466723_169316 | 3300042618 | Bacteria | 3500 |
| 205 | Ga0466723_196272 | 3300042618 | Bacteria | 9187 |
| 206 | Ga0466723_201009 | 3300042618 | Bacteria | 3419 |
| 207 | Ga0466726_082119 | 3300042619 | Bacteria | 15276 |
| 208 | Ga0466726_367211 | 3300042619 | Bacteria | 8492 |
| 209 | Ga0466729_036462 | 3300042621 | Bacteria | 43819 |
| 210 | Ga0466705_074045 | 3300042612 | Bacteria | 13915 |
| 211 | Ga0466705_302784 | 3300042612 | Bacteria | 42430 |
| 212 | Ga0466733_056422 | 3300042659 | Bacteria | 3679 |
| 213 | Ga0530661_000436 | 3300056564 | Bacteria | 31065 |
| 214 | Ga0562377_0092 | 3300056842 | Bacteria | 331889 |
| 215 | Ga0562375_3653 | 3300056856 | Unclassified | 13813 |
| 216 | Ga0466690_094912 | 3300042590 | Bacteria | 11879 |
| 217 | Ga0466706_024998 | 3300042599 | Bacteria | 5292 |
| 218 | Ga0466706_027034 | 3300042599 | Unclassified | 2882 |
| 219 | Ga0466706_027682 | 3300042599 | Bacteria | 1845 |
| 220 | Ga0466706_216946 | 3300042599 | Bacteria | 2602 |
| 221 | Ga0466700_177700 | 3300042600 | Bacteria | 2646 |
| 222 | Ga0466707_025301 | 3300042601 | Bacteria | 2884 |
| 223 | Ga0466707_083059 | 3300042601 | Unclassified | 8514 |
| 224 | Ga0466707_349938 | 3300042601 | Unclassified | 4109 |
| 225 | Ga0466707_364923 | 3300042601 | Bacteria | 35785 |
| 226 | Ga0466713_014680 | 3300042602 | Bacteria | 48276 |
| 227 | Ga0466713_095745 | 3300042602 | Bacteria | 7610 |
| 228 | Ga0466713_111625 | 3300042602 | Bacteria | 2199 |
| 229 | Ga0466714_098364 | 3300042603 | Bacteria | 5951 |
| 230 | Ga0466717_272602 | 3300042604 | Bacteria | 4074 |
| 231 | Ga0466717_287154 | 3300042604 | Bacteria | 1982 |
| 232 | Ga0466716_179929 | 3300042605 | Bacteria | 1661 |
| 233 | Ga0466719_094347 | 3300042606 | Bacteria | 9768 |
| 234 | Ga0123355_10007966 | 3300009826 | Bacteria | 15968 |
| 235 | Ga0123355_10207266 | 3300009826 | Unclassified | 2849 |
| 236 | Ga0123353_10003083 | 3300010167 | Bacteria | 20883 |
| 237 | Ga0123353_10155245 | 3300010167 | Bacteria | 3650 |
| 238 | Ga0123354_10000004 | 3300010882 | Bacteria | 302459 |
| 239 | 2227178015 | 2225789004 | Archaea | 8117 |
| 240 | 2227629066 | 2225789004 | Bacteria | 2135 |
| 241 | IMNBL1DRAFT_c0000058 | 3300000062 | Bacteria | 106146 |
| 242 | IMNBL1DRAFT_c0000099 | 3300000062 | Bacteria | 76643 |
| 243 | IMNBL1DRAFT_c0000272 | 3300000062 | Bacteria | 45809 |
| 244 | IMNBL1DRAFT_c0002635 | 3300000062 | Bacteria | 12274 |
| 245 | JGI24698J34947_10009195 | 3300002449 | Bacteria | 5422 |
| 246 | JGI24698J34947_10015919 | 3300002449 | Unclassified | 4089 |
| 247 | JGI24698J34947_10025741 | 3300002449 | Bacteria | 3129 |
| 248 | Ga0068305_10009364 | 3300005083 | Unclassified | 49869 |
| 249 | Ga0068305_10102212 | 3300005083 | Bacteria | 2912 |
| 250 | Ga0072940_1135126 | 3300005200 | Bacteria | 5367 |
| 251 | Ga0466734_159675 | 3300042623 | Archaea | 5056 |
| 252 | Ga0466735_168601 | 3300042624 | Bacteria | 6853 |
| 253 | Ga0466703_217831 | 3300042636 | Bacteria | 34096 |
| 254 | Ga0466708_013328 | 3300042652 | Bacteria | 3965 |
| 255 | Ga0466708_422792 | 3300042652 | Bacteria | 4769 |
| 256 | Ga0466727_272495 | 3300042655 | Bacteria | 8751 |
| 257 | Ga0466727_342717 | 3300042655 | Archaea | 14012 |
| 258 | Ga0466705_390028 | 3300042612 | Bacteria | 6954 |
| 259 | Ga0466715_016124 | 3300042616 | Bacteria | 4174 |
| 260 | Ga0466715_040819 | 3300042616 | Bacteria | 5136 |
| 261 | Ga0466726_247869 | 3300042619 | Bacteria | 2939 |
| 262 | Ga0466726_307867 | 3300042619 | Unclassified | 25587 |
| 263 | Ga0466726_441451 | 3300042619 | Bacteria | 10504 |
| 264 | Ga0466705_038326 | 3300042612 | Bacteria | 9889 |
| 265 | Ga0466705_078680 | 3300042612 | Bacteria | 1644 |
| 266 | Ga0466705_159727 | 3300042612 | Bacteria | 25299 |
| 267 | Ga0466705_310460 | 3300042612 | Unclassified | 2707 |
| 268 | Ga0466705_336692 | 3300042612 | Bacteria | 60317 |
| 269 | Ga0562375_0009 | 3300056856 | Bacteria | 1746158 |
| 270 | Ga0264413_110692 | 3300024493 | Bacteria | 27397 |
| 271 | Ga0466693_203062 | 3300042592 | Archaea | 5394 |
| 272 | Ga0466696_160160 | 3300042596 | Bacteria | 4984 |
| 273 | Ga0466696_196668 | 3300042596 | Bacteria | 24129 |
| 274 | Ga0466701_018261 | 3300042598 | Archaea | 4778 |
| 275 | Ga0466706_100146 | 3300042599 | Bacteria | 19697 |
| 276 | Ga0466706_123030 | 3300042599 | Bacteria | 58541 |
| 277 | Ga0466700_210455 | 3300042600 | Bacteria | 3062 |
| 278 | Ga0466707_034346 | 3300042601 | Bacteria | 62797 |
| 279 | Ga0466707_135141 | 3300042601 | Unclassified | 2752 |
| 280 | Ga0466707_359822 | 3300042601 | Bacteria | 4176 |
| 281 | Ga0466707_385138 | 3300042601 | Bacteria | 24160 |
| 282 | Ga0466713_089196 | 3300042602 | Bacteria | 75262 |
| 283 | Ga0466719_116814 | 3300042606 | Bacteria | 21008 |
| 284 | Ga0466719_125589 | 3300042606 | Bacteria | 18818 |
| 285 | Ga0466719_366923 | 3300042606 | Bacteria | 2133 |
| 286 | Ga0123357_10005355 | 3300009784 | Unclassified | 15350 |
| 287 | Ga0123357_10090541 | 3300009784 | Bacteria | 3989 |
| 288 | Ga0123357_10107540 | 3300009784 | Bacteria | 3571 |
| 289 | Ga0123357_10195025 | 3300009784 | Bacteria | 2322 |
| 290 | Ga0123355_10001446 | 3300009826 | Bacteria | 33057 |
| 291 | Ga0123355_10002862 | 3300009826 | Bacteria | 24522 |
| 292 | Ga0123355_10301918 | 3300009826 | Bacteria | 2181 |
| 293 | Ga0123356_10000670 | 3300010049 | Bacteria | 37848 |
| 294 | Ga0123356_10000908 | 3300010049 | Bacteria | 32764 |
| 295 | Ga0123356_10008531 | 3300010049 | Bacteria | 10179 |
| 296 | Ga0123353_10000492 | 3300010167 | Bacteria | 48805 |
| 297 | Ga0123353_10012627 | 3300010167 | Bacteria | 12028 |
| 298 | Ga0123353_10420257 | 3300010167 | Bacteria | 1981 |
| 299 | Ga0123353_10444195 | 3300010167 | Bacteria | 1912 |
| 300 | Ga0123354_10021622 | 3300010882 | Unclassified | 10138 |
| 301 | IMNBL1DRAFT_c0000075 | 3300000062 | Archaea | 89768 |
| 302 | IMNBL1DRAFT_c0003761 | 3300000062 | Bacteria | 9493 |
| 303 | IMNBL1DRAFT_c0006401 | 3300000062 | Unclassified | 6439 |
| 304 | IMNBL1DRAFT_c0006861 | 3300000062 | Bacteria | 6120 |
| 305 | JGI24702J35022_10000814 | 3300002462 | Bacteria | 19290 |
| 306 | Ga0068305_10093986 | 3300005083 | Bacteria | 2068 |
| 307 | Ga0072941_1227244 | 3300005201 | Bacteria | 4820 |
| 308 | Ga0123357_10001077 | 3300009784 | Bacteria | 28163 |
| 309 | Ga0466729_299881 | 3300042621 | Bacteria | 3039 |
| 310 | Ga0466703_205570 | 3300042636 | Bacteria | 6156 |
| 311 | Ga0466704_019649 | 3300042643 | Unclassified | 7620 |
| 312 | Ga0466704_047973 | 3300042643 | Bacteria | 6917 |
| 313 | Ga0466704_573644 | 3300042643 | Unclassified | 3425 |
| 314 | Ga0466709_021706 | 3300042648 | Unclassified | 32706 |
| 315 | Ga0466708_085987 | 3300042652 | Bacteria | 1371 |
| 316 | Ga0466711_055433 | 3300042615 | Bacteria | 29694 |
| 317 | Ga0466711_168698 | 3300042615 | Bacteria | 2733 |
| 318 | Ga0466711_487477 | 3300042615 | Bacteria | 15466 |
| 319 | Ga0466715_600308 | 3300042616 | Bacteria | 3374 |
| 320 | Ga0466718_032861 | 3300042617 | Archaea | 23137 |
| 321 | Ga0466723_053943 | 3300042618 | Bacteria | 3538 |
| 322 | Ga0466726_068618 | 3300042619 | Bacteria | 73201 |
| 323 | Ga0466726_241413 | 3300042619 | Bacteria | 4127 |
| 324 | Ga0466729_172996 | 3300042621 | Bacteria | 1715 |
| 325 | Ga0466705_022138 | 3300042612 | Bacteria | 8156 |
| 326 | Ga0466733_141383 | 3300042659 | Bacteria | 2344 |
| 327 | Ga0562379_0049 | 3300056790 | Bacteria | 522222 |
| 328 | Ga0562378_0023 | 3300056814 | Bacteria | 658297 |
| 329 | Ga0562375_0001 | 3300056856 | Bacteria | 3661630 |
| 330 | Ga0562376_2952 | 3300056857 | Unclassified | 18640 |
| 331 | Ga0562374_0248 | 3300057007 | Bacteria | 108733 |
| 332 | Ga0562374_1275 | 3300057007 | Bacteria | 30727 |
| 333 | Ga0160443_100038 | 3300012848 | Bacteria | 324841 |
| 334 | Ga0415639_052664 | 3300038395 | Bacteria | 5430 |
| 335 | Ga0415639_107583 | 3300038395 | Bacteria | 1734 |
| 336 | Ga0466691_062845 | 3300042593 | Bacteria | 3274 |
| 337 | Ga0466695_046546 | 3300042595 | Bacteria | 21587 |
| 338 | Ga0466696_032756 | 3300042596 | Bacteria | 8028 |
| 339 | Ga0466706_002301 | 3300042599 | Bacteria | 28739 |
| 340 | Ga0466706_184841 | 3300042599 | Unclassified | 5724 |
| 341 | Ga0466706_270174 | 3300042599 | Bacteria | 5765 |
| 342 | Ga0466707_131759 | 3300042601 | Bacteria | 2009 |
| 343 | Ga0466714_019512 | 3300042603 | Bacteria | 106490 |
| 344 | Ga0466714_025241 | 3300042603 | Bacteria | 3526 |
| 345 | Ga0466714_082277 | 3300042603 | Bacteria | 2949 |
| 346 | Ga0466716_475246 | 3300042605 | Bacteria | 3716 |
| 347 | Ga0466719_425208 | 3300042606 | Bacteria | 4220 |
| 348 | Ga0123355_10052895 | 3300009826 | Bacteria | 6586 |
| 349 | Ga0123355_10277600 | 3300009826 | Unclassified | 2318 |
| 350 | Ga0123356_10009115 | 3300010049 | Bacteria | 9814 |
| 351 | Ga0123353_10000654 | 3300010167 | Bacteria | 42445 |
| 352 | Ga0123353_10027525 | 3300010167 | Bacteria | 8714 |
| 353 | 2227303024 | 2225789004 | Bacteria | 6590 |
| 354 | 2227556565 | 2225789004 | Bacteria | 2780 |
| 355 | JGI24703J35330_11748845 | 3300002501 | Bacteria | 48088 |
| 356 | Ga0068302_10021919 | 3300005071 | Bacteria | 12846 |
| 357 | Ga0466731_144629 | 3300042622 | Bacteria | 2851 |
| 358 | Ga0466735_215016 | 3300042624 | Bacteria | 5128 |
| 359 | Ga0466702_140898 | 3300042635 | Bacteria | 32738 |
| 360 | Ga0466703_039051 | 3300042636 | Archaea | 24197 |
| 361 | Ga0466703_311241 | 3300042636 | Bacteria | 29563 |
| 362 | Ga0466704_087874 | 3300042643 | Unclassified | 2570 |
| 363 | Ga0466704_135304 | 3300042643 | Bacteria | 14113 |
| 364 | Ga0466704_319802 | 3300042643 | Bacteria | 4872 |
| 365 | Ga0466709_018524 | 3300042648 | Bacteria | 3456 |
| 366 | Ga0466709_393361 | 3300042648 | Bacteria | 1915 |
| 367 | Ga0466708_292414 | 3300042652 | Bacteria | 8890 |
| 368 | Ga0466705_439343 | 3300042612 | Bacteria | 236994 |
| 369 | Ga0466715_063259 | 3300042616 | Bacteria | 2602 |
| 370 | Ga0466726_088707 | 3300042619 | Bacteria | 4279 |
| 371 | Ga0466726_352530 | 3300042619 | Bacteria | 1364 |
| 372 | Ga0466705_162027 | 3300042612 | Unclassified | 12541 |
| 373 | Ga0466733_048053 | 3300042659 | Bacteria | 2211 |
| 374 | Ga0562379_0116 | 3300056790 | Unclassified | 252589 |
| 375 | Ga0562375_0163 | 3300056856 | Bacteria | 195962 |
| 376 | Ga0562376_0097 | 3300056857 | Bacteria | 201403 |
| 377 | Ga0562376_0176 | 3300056857 | Bacteria | 134349 |
| 378 | Ga0466693_413571 | 3300042592 | Bacteria | 6864 |
| 379 | Ga0466691_003227 | 3300042593 | Bacteria | 54826 |
| 380 | Ga0466691_061168 | 3300042593 | Bacteria | 13255 |
| 381 | Ga0466696_076181 | 3300042596 | Bacteria | 2883 |
| 382 | Ga0466706_010625 | 3300042599 | Bacteria | 4146 |
| 383 | Ga0466706_020975 | 3300042599 | Bacteria | 7549 |
| 384 | Ga0466706_103570 | 3300042599 | Bacteria | 9069 |
| 385 | Ga0466700_286994 | 3300042600 | Bacteria | 2403 |
| 386 | Ga0466707_059258 | 3300042601 | Bacteria | 1755 |
| 387 | Ga0466707_309864 | 3300042601 | Bacteria | 12821 |
| 388 | Ga0466707_312090 | 3300042601 | Bacteria | 2944 |
| 389 | Ga0466707_382424 | 3300042601 | Bacteria | 5618 |
| 390 | Ga0466707_416679 | 3300042601 | Bacteria | 126598 |
| 391 | Ga0466713_039290 | 3300042602 | Bacteria | 24711 |
| 392 | Ga0466714_120219 | 3300042603 | Archaea | 5128 |
| 393 | Ga0466719_040184 | 3300042606 | Unclassified | 4720 |
| 394 | Ga0466719_075102 | 3300042606 | Bacteria | 3876 |
| 395 | Ga0466719_292419 | 3300042606 | Bacteria | 3538 |
| 396 | Ga0466719_383974 | 3300042606 | Bacteria | 3265 |
| 397 | Ga0466722_029442 | 3300042609 | Bacteria | 2720 |
| 398 | Ga0123356_10012713 | 3300010049 | Bacteria | 8154 |
| 399 | Ga0123353_10219733 | 3300010167 | Bacteria | 2972 |
| 400 | Ga0123354_10103757 | 3300010882 | Bacteria | 3821 |
| 401 | 2227164136 | 2225789004 | Bacteria | 35357 |
| 402 | 2227491311 | 2225789004 | Archaea | 20388 |
| 403 | 2227519640 | 2225789004 | Bacteria | 3368 |
| 404 | IMNBL1DRAFT_c0000014 | 3300000062 | Archaea | 180092 |
| 405 | IMNBL1DRAFT_c0003590 | 3300000062 | Bacteria | 9843 |
| 406 | JGI24702J35022_10021713 | 3300002462 | Bacteria | 3479 |
| 407 | JGI24705J35276_12234755 | 3300002504 | Archaea | 5811 |
| 408 | Ga0072941_1001155 | 3300005201 | Bacteria | 57693 |
| 409 | Ga0466735_197153 | 3300042624 | Bacteria | 3192 |
| 410 | Ga0466730_092100 | 3300042625 | Bacteria | 2469 |
| 411 | Ga0466703_026096 | 3300042636 | Bacteria | 85498 |
| 412 | Ga0466704_430945 | 3300042643 | Unclassified | 4060 |
| 413 | Ga0466709_153773 | 3300042648 | Bacteria | 6752 |
| 414 | Ga0466708_041336 | 3300042652 | Bacteria | 18684 |
| 415 | Ga0466708_180955 | 3300042652 | Bacteria | 9875 |
| 416 | Ga0466727_091033 | 3300042655 | Bacteria | 2944 |
| 417 | Ga0466705_399613 | 3300042612 | Bacteria | 12670 |
| 418 | Ga0466705_404976 | 3300042612 | Bacteria | 25322 |
| 419 | Ga0466715_072560 | 3300042616 | Bacteria | 45498 |
| 420 | Ga0466715_429272 | 3300042616 | Bacteria | 41809 |
| 421 | Ga0466715_600378 | 3300042616 | Bacteria | 4500 |
| 422 | Ga0466723_222184 | 3300042618 | Bacteria | 10903 |
| 423 | Ga0466726_445251 | 3300042619 | Bacteria | 5796 |
| 424 | Ga0466729_011217 | 3300042621 | Archaea | 12852 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05167 | DUF711 | Uncharacterised ACR (DUF711) | 244 | 468 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.