Protein Family IF01364

Metagenome Isolate
124 Members
52 Samples
103 Scaffolds
353.37 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1202651|Ga0072941_120265111
Length
389 aa
Sequence
VEKVLMKGNEAIAEAAIMAGCRHFFGYPITPQNEIAAYMSKRMPKIGGTYLQAESEIAAVNMVIGAAAAGVRAMTSSSSPGIALKSEGISYLAGCDLPAVIVNVQRGGPGLGTIQPSQADYYLATRSPGHGDFHMFVLAPNSIQEMLDQTRKAFDIADKYRICVMLLADGILGQMMEPAIIAPISEPTAGETAGSNTDSFAKTPEKSWAVTGTGGKRKKNVISSLYLQPEELERRNIERFEKYKLIAETEADYESYMADDADIILVSYGAASRICKNAIALARDIGIKAGLIRPITLWPFPKKALLAKADSVQAFISVEMSMGQMIDDVLLATECRKPVYLCSRAGGAIHTPEDILAKIKEAAGVEKHTASYVKTAHGAGERAVKEGI*

📊 Sample Types

Isolate 16.9%
Metagenome 83.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.1%
Termitidae 31.4%
Kalotermitidae 13.7%
Rhinotermitidae 5.9%
Hodotermitidae 2.0%
Termopsidae 2.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2791354839 Unclassified Chloroflexi Co191P4bin10 Isolate Unclassified
2 2791354849 Unclassified Chloroflexi Lab288P3bin29 Isolate Unclassified
3 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
4 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 2791354848 Unclassified Chloroflexi Emb289P3bin155 Isolate Unclassified
15 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
23 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
26 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
30 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
31 2820730639 Unclassified Chloroflexi Th196P4bin31 Isolate Unclassified
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
39 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
43 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
48 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
49 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
50 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
51 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10000574 3300010167 Bacteria 44995
2 Ga0123353_10111466 3300010167 Bacteria 4407
3 Ga0123353_10249751 3300010167 Bacteria 2749
4 Ga0466733_191492 3300042659 Bacteria 3034
5 Ga0123353_10053956 3300010167 Bacteria 6425
6 Ga0123353_10059251 3300010167 Bacteria 6138
7 Ga0123353_10306788 3300010167 Bacteria 2419
8 Ga0123353_10308386 3300010167 Bacteria 2411
9 Ga0123353_10518233 3300010167 Bacteria 1731
10 Ga0415639_013760 3300038395 Bacteria 13189
11 Ga0466696_105196 3300042596 Bacteria 26096
12 JGI24702J35022_10002589 3300002462 Bacteria 10993
13 JGI24702J35022_10015189 3300002462 Bacteria 4241
14 JGI24696J40584_12961398 3300002834 Bacteria 15065
15 Ga0466700_030605 3300042600 Bacteria 2823
16 Ga0466714_094296 3300042603 Bacteria 1905
17 Ga0466714_127961 3300042603 Bacteria 26473
18 Ga0466729_272174 3300042621 Bacteria 94053
19 Ga0466703_404120 3300042636 Bacteria 2795
20 Ga0466704_312129 3300042643 Bacteria 70462
21 Ga0123355_10251251 3300009826 Bacteria 2489
22 Ga0123355_10288281 3300009826 Bacteria 2256
23 Ga0123356_10001683 3300010049 Bacteria 24208
24 Ga0123356_10045425 3300010049 Bacteria 4087
25 Ga0123356_10538691 3300010049 Bacteria 1327
26 Ga0123353_10000456 3300010167 Bacteria 50915
27 Ga0123353_10010673 3300010167 Bacteria 12838
28 Ga0123353_10025187 3300010167 Bacteria 9058
29 Ga0123353_10032172 3300010167 Bacteria 8142
30 Ga0123353_10036373 3300010167 Bacteria 7711
31 Ga0123353_10335704 3300010167 Bacteria 2285
32 Ga0415639_002902 3300038395 Bacteria 9464
33 Ga0415639_067410 3300038395 Bacteria 1895
34 Ga0415639_134406 3300038395 Bacteria 2464
35 Ga0466696_221706 3300042596 Bacteria 1806
36 Ga0466712_171532 3300042614 Bacteria 3122
37 Ga0466711_165094 3300042615 Bacteria 9865
38 Ga0466711_507541 3300042615 Bacteria 2254
39 Ga0466714_101649 3300042603 Bacteria 8511
40 Ga0466719_134466 3300042606 Bacteria 4500
41 Ga0123356_10004472 3300010049 Bacteria 14442
42 Ga0123356_10618898 3300010049 Bacteria 1248
43 Ga0123353_10009526 3300010167 Bacteria 13424
44 Ga0123353_10059280 3300010167 Bacteria 6137
45 Ga0415639_009798 3300038395 Bacteria 17327
46 Ga0466692_107783 3300042591 Bacteria 51155
47 Ga0466711_253729 3300042615 Bacteria 10943
48 Ga0466706_156744 3300042599 Bacteria 14182
49 Ga0466704_002184 3300042643 Bacteria 8215
50 Ga0466727_273117 3300042655 Bacteria 7884
51 Ga0123356_10007323 3300010049 Bacteria 11010
52 Ga0123356_10207692 3300010049 Bacteria 2004
53 Ga0123353_10013643 3300010167 Bacteria 11651
54 Ga0123353_10023406 3300010167 Bacteria 9351
55 Ga0123353_10091029 3300010167 Bacteria 4913
56 Ga0123354_10050058 3300010882 Bacteria 6329
57 Ga0415639_004978 3300038395 Bacteria 28196
58 Ga0415639_154481 3300038395 Bacteria 1831
59 Ga0466705_505683 3300042612 Bacteria 150209
60 JGI24702J35022_10002880 3300002462 Bacteria 10413
61 Ga0466706_105176 3300042599 Bacteria 2119
62 Ga0466700_171219 3300042600 Bacteria 50117
63 Ga0466714_119471 3300042603 Bacteria 28498
64 Ga0466722_228299 3300042609 Bacteria 4354
65 Ga0466698_153970 3300042610 Unclassified 1124
66 Ga0466727_245681 3300042655 Bacteria 65513
67 Ga0123353_10026196 3300010167 Bacteria 8900
68 Ga0415639_167601 3300038395 Bacteria 2722
69 Ga0466715_082296 3300042616 Bacteria 2191
70 Ga0466729_168296 3300042621 Bacteria 14413
71 IMNBL1DRAFT_c0001091 3300000062 Bacteria 20833
72 JGI24702J35022_10016037 3300002462 Bacteria 4113
73 Ga0068305_10008099 3300005083 Bacteria 232741
74 Ga0072941_1000016 3300005201 Bacteria 165423
75 Ga0072941_1202651 3300005201 Bacteria 16810
76 Ga0466706_001485 3300042599 Bacteria 8842
77 Ga0466702_326241 3300042635 Bacteria 1433
78 Ga0123356_10001877 3300010049 Bacteria 22775
79 Ga0123353_10021310 3300010167 Bacteria 9724
80 Ga0123353_10204036 3300010167 Bacteria 3107
81 Ga0415639_003475 3300038395 Bacteria 16871
82 Ga0415639_009527 3300038395 Bacteria 6784
83 Ga0466693_448736 3300042592 Bacteria 1473
84 Ga0466699_165713 3300042597 Bacteria 3382
85 JGI24702J35022_10000516 3300002462 Bacteria 23358
86 JGI24702J35022_10071557 3300002462 Bacteria 1868
87 JGI24696J40584_12957257 3300002834 Bacteria 3422
88 Ga0466714_089986 3300042603 Bacteria 6036
89 Ga0466719_548830 3300042606 Unclassified 5735
90 Ga0466722_200848 3300042609 Bacteria 5361
91 Ga0123357_10135837 3300009784 Bacteria 3043
92 Ga0123356_10021054 3300010049 Bacteria 6167
93 Ga0123353_10001865 3300010167 Bacteria 25941
94 Ga0123353_10028168 3300010167 Bacteria 8626
95 Ga0123353_10067379 3300010167 Bacteria 5748
96 Ga0123353_10073298 3300010167 Bacteria 5503
97 Ga0123353_10475944 3300010167 Bacteria 1829
98 Ga0415639_001309 3300038395 Bacteria 13702
99 Ga0415639_070253 3300038395 Bacteria 2334
100 IMNBL1DRAFT_c0001485 3300000062 Bacteria 17482
101 JGI24702J35022_10001756 3300002462 Bacteria 13398
102 JGI24702J35022_10023542 3300002462 Bacteria 3329
103 Ga0466706_184294 3300042599 Bacteria 37254

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II 261 355 0.99
PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg 14 185 0.92
PF02780 Transketolase_C Transketolase, C-terminal domain 259 319 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01855 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.