Protein Family IF01276
Metagenome
Isolate
137
Members
52
Samples
125
Scaffolds
187.42
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1005806|Ga0072941_100580622
- Length
- 215 aa
- Sequence
- LVRASAKRRVPSKKDFKGFKQELIVSDLGYLEIILIAIGLSMDAFAVSITLGLSVKKPRLKEFVIPGIYFGAFQALMPLIGYFAGTIFASKIKTLDHWIAFVLLGLIGGKMIKESFSKDEEKSGRNSFQFLNMLLLAVATSIDALAVGVTFAFFEINIFIAIIIIGFTTCVISIGGVKIGNIFGAKFKSKAELLGGVVLVGLGVKILIEHLLGA*
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
20.0%
Blattidae
8.0%
Kalotermitidae
8.0%
Rhinotermitidae
4.0%
Passalidae
4.0%
Termopsidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
3
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 4 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 26 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 45 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 46 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 47 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 48 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_055841 | 3300042612 | Bacteria | 3711 |
| 2 | Ga0466733_004874 | 3300042659 | Bacteria | 4615 |
| 3 | JGI24696J40584_12841760 | 3300002834 | Archaea | 956 |
| 4 | Ga0072941_1036905 | 3300005201 | Bacteria | 2334 |
| 5 | Ga0466735_168918 | 3300042624 | Bacteria | 23518 |
| 6 | Ga0466702_080526 | 3300042635 | Bacteria | 1636 |
| 7 | Ga0466704_022623 | 3300042643 | Bacteria | 3025 |
| 8 | Ga0466704_295770 | 3300042643 | Bacteria | 15382 |
| 9 | Ga0466727_193470 | 3300042655 | Bacteria | 2352 |
| 10 | Ga0466713_073833 | 3300042602 | Bacteria | 1308 |
| 11 | Ga0466721_187392 | 3300042608 | Bacteria | 20917 |
| 12 | Ga0123355_10186380 | 3300009826 | Bacteria | 3067 |
| 13 | Ga0123355_10586226 | 3300009826 | Bacteria | 1330 |
| 14 | Ga0123356_10062228 | 3300010049 | Bacteria | 3486 |
| 15 | Ga0123356_11021271 | 3300010049 | Archaea | 997 |
| 16 | JGI24698J34947_10006755 | 3300002449 | Unclassified | 6303 |
| 17 | Ga0072940_1010726 | 3300005200 | Bacteria | 2783 |
| 18 | Ga0072940_1109580 | 3300005200 | Bacteria | 5769 |
| 19 | Ga0466702_089869 | 3300042635 | Bacteria | 3702 |
| 20 | Ga0466702_110929 | 3300042635 | Bacteria | 2903 |
| 21 | Ga0466702_426890 | 3300042635 | Bacteria | 1463 |
| 22 | Ga0466704_357422 | 3300042643 | Bacteria | 8136 |
| 23 | Ga0466722_005177 | 3300042609 | Bacteria | 19765 |
| 24 | Ga0466698_167347 | 3300042610 | Bacteria | 8204 |
| 25 | Ga0466657_390072 | 3300042582 | Bacteria | 1072 |
| 26 | Ga0466695_258997 | 3300042595 | Bacteria | 3807 |
| 27 | Ga0466699_205337 | 3300042597 | Bacteria | 2910 |
| 28 | Ga0466705_517110 | 3300042612 | Bacteria | 2185 |
| 29 | Ga0466728_382973 | 3300042620 | Bacteria | 2329 |
| 30 | Ga0123355_10336219 | 3300009826 | Bacteria | 2017 |
| 31 | Ga0123356_10102912 | 3300010049 | Bacteria | 2742 |
| 32 | Ga0123356_10579759 | 3300010049 | Bacteria | 1285 |
| 33 | Ga0123356_10631719 | 3300010049 | Bacteria | 1237 |
| 34 | Ga0123356_11340117 | 3300010049 | Bacteria | 878 |
| 35 | Ga0123353_10969515 | 3300010167 | Bacteria | 1147 |
| 36 | Ga0466697_226254 | 3300042611 | Bacteria | 10741 |
| 37 | Ga0466705_084921 | 3300042612 | Bacteria | 13846 |
| 38 | Ga0466732_287850 | 3300042656 | Bacteria | 21763 |
| 39 | IMNBL1DRAFT_c0007498 | 3300000062 | Bacteria | 5728 |
| 40 | JGI24698J34947_10175204 | 3300002449 | Bacteria | 863 |
| 41 | JGI24695J34938_10000333 | 3300002450 | Bacteria | 46505 |
| 42 | JGI24702J35022_10025176 | 3300002462 | Bacteria | 3213 |
| 43 | Ga0072941_1005806 | 3300005201 | Bacteria | 29345 |
| 44 | Ga0466704_056605 | 3300042643 | Unclassified | 2285 |
| 45 | Ga0466714_077853 | 3300042603 | Bacteria | 1163 |
| 46 | Ga0466722_018164 | 3300042609 | Bacteria | 5235 |
| 47 | Ga0466693_230236 | 3300042592 | Bacteria | 1245 |
| 48 | Ga0466693_418251 | 3300042592 | Bacteria | 1568 |
| 49 | Ga0466694_193757 | 3300042594 | Bacteria | 7695 |
| 50 | Ga0466712_048578 | 3300042614 | Bacteria | 5374 |
| 51 | Ga0123356_10542329 | 3300010049 | Unclassified | 1323 |
| 52 | Ga0123356_10637057 | 3300010049 | Bacteria | 1232 |
| 53 | Ga0123356_10945120 | 3300010049 | Bacteria | 1033 |
| 54 | Ga0123356_10992137 | 3300010049 | Bacteria | 1010 |
| 55 | Ga0123353_12012867 | 3300010167 | Bacteria | 707 |
| 56 | Ga0123354_10112805 | 3300010882 | Bacteria | 3576 |
| 57 | Ga0466733_068599 | 3300042659 | Bacteria | 1976 |
| 58 | 2227324121 | 2225789004 | Unclassified | 1183 |
| 59 | IMNBL1DRAFT_c0032684 | 3300000062 | Bacteria | 1872 |
| 60 | Ga0072941_1000948 | 3300005201 | Bacteria | 58191 |
| 61 | Ga0466702_392271 | 3300042635 | Bacteria | 1534 |
| 62 | Ga0466704_361285 | 3300042643 | Bacteria | 3082 |
| 63 | Ga0466693_050918 | 3300042592 | Bacteria | 24778 |
| 64 | Ga0466705_480205 | 3300042612 | Bacteria | 1923 |
| 65 | Ga0123356_10286201 | 3300010049 | Bacteria | 1746 |
| 66 | Ga0123353_11755799 | 3300010167 | Bacteria | 774 |
| 67 | Ga0466732_093997 | 3300042656 | Archaea | 8509 |
| 68 | JGI24695J34938_10000383 | 3300002450 | Bacteria | 43842 |
| 69 | JGI24695J34938_10001843 | 3300002450 | Bacteria | 17250 |
| 70 | JGI24696J40584_12947824 | 3300002834 | Bacteria | 1969 |
| 71 | Ga0466702_390691 | 3300042635 | Bacteria | 1240 |
| 72 | Ga0466706_082975 | 3300042599 | Bacteria | 89571 |
| 73 | Ga0466692_089285 | 3300042591 | Bacteria | 1622 |
| 74 | Ga0466712_312444 | 3300042614 | Bacteria | 3358 |
| 75 | Ga0123356_11759065 | 3300010049 | Bacteria | 770 |
| 76 | Ga0123353_10326899 | 3300010167 | Bacteria | 2324 |
| 77 | Ga0466705_077523 | 3300042612 | Bacteria | 7299 |
| 78 | Ga0466705_085629 | 3300042612 | Bacteria | 9722 |
| 79 | IMNBL1DRAFT_c0096169 | 3300000062 | Unclassified | 803 |
| 80 | AustNasuHG_c1000770 | 3300000089 | Bacteria | 11416 |
| 81 | JGI24698J34947_10007125 | 3300002449 | Bacteria | 6142 |
| 82 | Ga0466704_199621 | 3300042643 | Unclassified | 5670 |
| 83 | Ga0466704_346774 | 3300042643 | Bacteria | 2179 |
| 84 | Ga0466706_253555 | 3300042599 | Bacteria | 1255 |
| 85 | Ga0466719_186154 | 3300042606 | Bacteria | 2536 |
| 86 | Ga0466721_273193 | 3300042608 | Bacteria | 9674 |
| 87 | Ga0466712_095058 | 3300042614 | Bacteria | 4854 |
| 88 | Ga0466718_092209 | 3300042617 | Bacteria | 73198 |
| 89 | Ga0123355_10000053 | 3300009826 | Bacteria | 119276 |
| 90 | Ga0123355_10081520 | 3300009826 | Bacteria | 5163 |
| 91 | Ga0123356_10004243 | 3300010049 | Bacteria | 14834 |
| 92 | Ga0123356_10023389 | 3300010049 | Bacteria | 5816 |
| 93 | Ga0123356_10793980 | 3300010049 | Unclassified | 1118 |
| 94 | Ga0123356_10840640 | 3300010049 | Bacteria | 1089 |
| 95 | Ga0123353_10593908 | 3300010167 | Bacteria | 1585 |
| 96 | Ga0466705_092404 | 3300042612 | Bacteria | 8046 |
| 97 | IMNBL1DRAFT_c0000422 | 3300000062 | Bacteria | 35538 |
| 98 | IMNBL1DRAFT_c0002399 | 3300000062 | Bacteria | 13046 |
| 99 | IMNBL1DRAFT_c0018897 | 3300000062 | Bacteria | 2846 |
| 100 | JGI24695J34938_10002136 | 3300002450 | Bacteria | 15441 |
| 101 | Ga0072941_1004345 | 3300005201 | Bacteria | 20059 |
| 102 | Ga0466702_248800 | 3300042635 | Bacteria | 1500 |
| 103 | Ga0466704_040953 | 3300042643 | Bacteria | 3065 |
| 104 | Ga0466704_058805 | 3300042643 | Bacteria | 5252 |
| 105 | Ga0466704_195645 | 3300042643 | Bacteria | 14131 |
| 106 | Ga0466704_315107 | 3300042643 | Bacteria | 2344 |
| 107 | Ga0466722_089112 | 3300042609 | Bacteria | 14630 |
| 108 | Ga0264413_116970 | 3300024493 | Bacteria | 5614 |
| 109 | Ga0466728_307371 | 3300042620 | Bacteria | 1441 |
| 110 | Ga0123355_10103631 | 3300009826 | Bacteria | 4471 |
| 111 | Ga0123355_10212685 | 3300009826 | Bacteria | 2799 |
| 112 | Ga0123355_10317850 | 3300009826 | Bacteria | 2102 |
| 113 | Ga0123355_10587744 | 3300009826 | Bacteria | 1328 |
| 114 | Ga0123355_11330344 | 3300009826 | Bacteria | 718 |
| 115 | Ga0123356_10120734 | 3300010049 | Bacteria | 2548 |
| 116 | Ga0123356_11309138 | 3300010049 | Bacteria | 888 |
| 117 | Ga0123353_10179179 | 3300010167 | Bacteria | 3357 |
| 118 | IMNBL1DRAFT_c0004943 | 3300000062 | Bacteria | 7796 |
| 119 | JGI24702J35022_10000366 | 3300002462 | Bacteria | 26831 |
| 120 | JGI24696J40584_12771010 | 3300002834 | Bacteria | 821 |
| 121 | Ga0466731_124913 | 3300042622 | Bacteria | 2186 |
| 122 | Ga0466735_056014 | 3300042624 | Bacteria | 1086 |
| 123 | Ga0466704_015223 | 3300042643 | Bacteria | 2730 |
| 124 | Ga0466707_074831 | 3300042601 | Bacteria | 74990 |
| 125 | Ga0466719_045509 | 3300042606 | Bacteria | 1494 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02659 | Mntp | Putative manganese efflux pump | 58 | 207 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.