Protein Family IF01264
Metagenome
Metatranscriptome
Isolate
133
Members
30
Samples
127
Scaffolds
122.83
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1001931|Ga0072941_100193113
- Length
- 146 aa
- Sequence
- MEDMLLETENHARANATPINAALANAPLVSSELGELLREHNGQNVSVLDLRGINNWTDFFIIATCTSRTHMDGLDRHIKEFCHEKKIDILGRSRKNTDDEWRLIDLGWIIIHLMTGRVREFYELERLWTPIPAPHTETPENTLEQ*
Sample Types
Isolate
4.5%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
74.1%
Unclassified
22.2%
Hodotermitidae
3.7%
Taxonomy
Archaea
0
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 4 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 5 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 6 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 15 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 30 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466718_066861 | 3300042617 | Bacteria | 4402 |
| 2 | Ga0466718_077729 | 3300042617 | Bacteria | 4189 |
| 3 | Ga0466694_164538 | 3300042594 | Bacteria | 11631 |
| 4 | Ga0466700_071651 | 3300042600 | Bacteria | 8111 |
| 5 | Ga0466720_066990 | 3300042607 | Bacteria | 2062 |
| 6 | JGI24698J34947_10002333 | 3300002449 | Bacteria | 10206 |
| 7 | JGI24698J34947_10006898 | 3300002449 | Bacteria | 6245 |
| 8 | JGI24695J34938_10002475 | 3300002450 | Bacteria | 14085 |
| 9 | JGI24695J34938_10002481 | 3300002450 | Bacteria | 14067 |
| 10 | JGI24695J34938_10004031 | 3300002450 | Bacteria | 9868 |
| 11 | Ga0072941_1003306 | 3300005201 | Bacteria | 11827 |
| 12 | Ga0466702_169627 | 3300042635 | Bacteria | 2000 |
| 13 | Ga0466702_420754 | 3300042635 | Bacteria | 5274 |
| 14 | Ga0123356_10000561 | 3300010049 | Bacteria | 41259 |
| 15 | Ga0123356_10326198 | 3300010049 | Bacteria | 1650 |
| 16 | Ga0123356_10377853 | 3300010049 | Bacteria | 1549 |
| 17 | Ga0466712_028735 | 3300042614 | Bacteria | 38990 |
| 18 | Ga0466718_041384 | 3300042617 | Bacteria | 2815 |
| 19 | Ga0466718_158197 | 3300042617 | Bacteria | 2149 |
| 20 | Ga0264413_111411 | 3300024493 | Bacteria | 5066 |
| 21 | Ga0415639_045627 | 3300038395 | Bacteria | 3298 |
| 22 | Ga0415639_045650 | 3300038395 | Bacteria | 1214 |
| 23 | Ga0466699_026438 | 3300042597 | Bacteria | 1241 |
| 24 | Ga0466699_266863 | 3300042597 | Bacteria | 3301 |
| 25 | Ga0466699_311237 | 3300042597 | Bacteria | 4063 |
| 26 | AustNasuHG_c1028290 | 3300000089 | Unclassified | 1678 |
| 27 | AustNasuHG_c1049480 | 3300000089 | Bacteria | 914 |
| 28 | FAAS_10001112 | 3300001880 | Bacteria | 902 |
| 29 | JGI24698J34947_10016364 | 3300002449 | Unclassified | 4025 |
| 30 | JGI24698J34947_10018088 | 3300002449 | Bacteria | 3813 |
| 31 | JGI24695J34938_10005353 | 3300002450 | Bacteria | 8026 |
| 32 | JGI24695J34938_10010014 | 3300002450 | Bacteria | 5228 |
| 33 | JGI24699J35502_10974609 | 3300002509 | Bacteria | 1249 |
| 34 | Ga0072941_1002220 | 3300005201 | Bacteria | 30258 |
| 35 | Ga0072941_1032280 | 3300005201 | Bacteria | 4236 |
| 36 | Ga0072941_1041343 | 3300005201 | Bacteria | 2135 |
| 37 | Ga0072941_1149915 | 3300005201 | Bacteria | 5103 |
| 38 | Ga0123353_10017884 | 3300010167 | Bacteria | 10451 |
| 39 | Ga0466712_016568 | 3300042614 | Bacteria | 28730 |
| 40 | Ga0466718_026446 | 3300042617 | Bacteria | 5425 |
| 41 | Ga0466718_052199 | 3300042617 | Bacteria | 17145 |
| 42 | Ga0466718_095657 | 3300042617 | Bacteria | 5234 |
| 43 | Ga0264413_142750 | 3300024493 | Bacteria | 1883 |
| 44 | Ga0466694_307484 | 3300042594 | Bacteria | 2878 |
| 45 | Ga0466699_279392 | 3300042597 | Unclassified | 2859 |
| 46 | Ga0466699_368046 | 3300042597 | Bacteria | 3673 |
| 47 | Ga0466720_014957 | 3300042607 | Unclassified | 4671 |
| 48 | AustNasuHG_c1010623 | 3300000089 | Bacteria | 3204 |
| 49 | AustNasuHG_c1034202 | 3300000089 | Bacteria | 1365 |
| 50 | JGI24695J34938_10027931 | 3300002450 | Bacteria | 2659 |
| 51 | Ga0072941_1032264 | 3300005201 | Bacteria | 3537 |
| 52 | Ga0072941_1038502 | 3300005201 | Bacteria | 4210 |
| 53 | Ga0072941_1228038 | 3300005201 | Bacteria | 1165 |
| 54 | Ga0466731_314586 | 3300042622 | Bacteria | 1579 |
| 55 | Ga0466702_249661 | 3300042635 | Bacteria | 4014 |
| 56 | Ga0123356_10004193 | 3300010049 | Bacteria | 14942 |
| 57 | Ga0123356_10016676 | 3300010049 | Bacteria | 7006 |
| 58 | Ga0466712_132436 | 3300042614 | Bacteria | 20729 |
| 59 | Ga0466718_168095 | 3300042617 | Bacteria | 2884 |
| 60 | Ga0466699_244450 | 3300042597 | Bacteria | 18921 |
| 61 | Ga0466699_269844 | 3300042597 | Bacteria | 2601 |
| 62 | JGI24698J34947_10000080 | 3300002449 | Bacteria | 31361 |
| 63 | JGI24695J34938_10003930 | 3300002450 | Bacteria | 10041 |
| 64 | JGI24695J34938_10023269 | 3300002450 | Bacteria | 2990 |
| 65 | Ga0072941_1001931 | 3300005201 | Bacteria | 39501 |
| 66 | Ga0072941_1002368 | 3300005201 | Bacteria | 28238 |
| 67 | Ga0466731_033519 | 3300042622 | Bacteria | 1676 |
| 68 | Ga0466702_035480 | 3300042635 | Bacteria | 2223 |
| 69 | Ga0466702_198617 | 3300042635 | Bacteria | 3467 |
| 70 | Ga0466712_002363 | 3300042614 | Bacteria | 21242 |
| 71 | Ga0466712_025614 | 3300042614 | Unclassified | 4159 |
| 72 | Ga0255786_1033624 | 3300022815 | Bacteria | 1273 |
| 73 | Ga0264413_100539 | 3300024493 | Bacteria | 37798 |
| 74 | Ga0415639_087345 | 3300038395 | Bacteria | 1450 |
| 75 | Ga0466694_089659 | 3300042594 | Bacteria | 2970 |
| 76 | AustNasuHG_c1013975 | 3300000089 | Bacteria | 2742 |
| 77 | AustNasuHG_c1038204 | 3300000089 | Bacteria | 1212 |
| 78 | FAAS_10645431 | 3300001880 | Bacteria | 507 |
| 79 | JGI24695J34938_10001205 | 3300002450 | Bacteria | 22922 |
| 80 | JGI24695J34938_10003864 | 3300002450 | Bacteria | 10144 |
| 81 | JGI24695J34938_10077634 | 3300002450 | Bacteria | 1377 |
| 82 | Ga0072941_1074943 | 3300005201 | Bacteria | 1540 |
| 83 | Ga0466712_037480 | 3300042614 | Bacteria | 1400 |
| 84 | Ga0264413_107334 | 3300024493 | Bacteria | 4269 |
| 85 | Ga0264413_138031 | 3300024493 | Bacteria | 2874 |
| 86 | Ga0466694_078502 | 3300042594 | Bacteria | 33638 |
| 87 | Ga0466694_241471 | 3300042594 | Bacteria | 3379 |
| 88 | Ga0466706_176251 | 3300042599 | Bacteria | 3567 |
| 89 | JGI24698J34947_10001448 | 3300002449 | Bacteria | 12467 |
| 90 | JGI24698J34947_10011017 | 3300002449 | Bacteria | 4960 |
| 91 | JGI24698J34947_10025598 | 3300002449 | Bacteria | 3140 |
| 92 | JGI24698J34947_10037691 | 3300002449 | Bacteria | 2511 |
| 93 | JGI24698J34947_10202035 | 3300002449 | Unclassified | 777 |
| 94 | JGI24695J34938_10005072 | 3300002450 | Bacteria | 8372 |
| 95 | JGI24695J34938_10005648 | 3300002450 | Bacteria | 7730 |
| 96 | Ga0072940_1184327 | 3300005200 | Bacteria | 4785 |
| 97 | Ga0123356_10000673 | 3300010049 | Bacteria | 37817 |
| 98 | Ga0123356_10012336 | 3300010049 | Bacteria | 8298 |
| 99 | Ga0123356_10549586 | 3300010049 | Bacteria | 1316 |
| 100 | Ga0466712_099818 | 3300042614 | Bacteria | 14525 |
| 101 | Ga0466712_155179 | 3300042614 | Bacteria | 14401 |
| 102 | Ga0466712_240349 | 3300042614 | Bacteria | 5826 |
| 103 | Ga0466718_003822 | 3300042617 | Bacteria | 10239 |
| 104 | Ga0466718_025602 | 3300042617 | Bacteria | 4946 |
| 105 | Ga0466718_093252 | 3300042617 | Bacteria | 8061 |
| 106 | JGI24698J34947_10001529 | 3300002449 | Bacteria | 12244 |
| 107 | JGI24698J34947_10005092 | 3300002449 | Bacteria | 7201 |
| 108 | Ga0072940_1023435 | 3300005200 | Bacteria | 1392 |
| 109 | Ga0466732_029143 | 3300042656 | Bacteria | 8918 |
| 110 | Ga0123356_10000865 | 3300010049 | Bacteria | 33632 |
| 111 | Ga0466712_036364 | 3300042614 | Bacteria | 3848 |
| 112 | Ga0466712_096745 | 3300042614 | Bacteria | 43904 |
| 113 | Ga0466718_007691 | 3300042617 | Bacteria | 7899 |
| 114 | Ga0415639_034121 | 3300038395 | Bacteria | 6028 |
| 115 | Ga0415639_041953 | 3300038395 | Bacteria | 1636 |
| 116 | Ga0415639_130993 | 3300038395 | Unclassified | 2692 |
| 117 | Ga0466693_134613 | 3300042592 | Bacteria | 2876 |
| 118 | Ga0466694_003523 | 3300042594 | Bacteria | 13955 |
| 119 | Ga0466694_043622 | 3300042594 | Bacteria | 5303 |
| 120 | Ga0466694_251773 | 3300042594 | Bacteria | 56431 |
| 121 | JGI24698J34947_10000264 | 3300002449 | Bacteria | 22404 |
| 122 | JGI24698J34947_10003800 | 3300002449 | Unclassified | 8225 |
| 123 | JGI24695J34938_10000053 | 3300002450 | Bacteria | 90544 |
| 124 | JGI24695J34938_10001095 | 3300002450 | Bacteria | 24483 |
| 125 | JGI24695J34938_10002277 | 3300002450 | Bacteria | 14816 |
| 126 | Ga0072940_1011714 | 3300005200 | Bacteria | 5340 |
| 127 | Ga0074263_147457 | 3300005485 | Bacteria | 765 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02410 | RsfS | Ribosomal silencing factor during starvation | 34 | 128 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.