Protein Family IF01259

Metagenome Metatranscriptome Isolate
230 Members
73 Samples
196 Scaffolds
118.04 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1569268|Ga0072940_15692681
Length
124 aa
Sequence
MTRVKRSVSARKKRRVILARASGYYGAKSRTYRAAKDQVTHSLAYAHRDRRNKKRNIRRLWITRINAAARQNGLSYSVFMNGLKRAGVMLDRKVLADIAVNDETAFSALAEIARKALEVAA*N*

📊 Sample Types

Isolate 14.8%
Metagenome 83.9%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 46.6%
Termitidae 32.9%
Kalotermitidae 12.3%
Termopsidae 2.7%
Passalidae 2.7%
Hodotermitidae 1.4%
Rhinotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 200
Eukaryota 0
Viruses 0
Unclassified 30

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
2 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
3 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
4 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
14 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
15 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
22 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
23 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
24 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
25 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
26 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
27 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
31 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
32 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
33 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
34 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
35 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
41 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
42 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
43 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
44 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
45 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
46 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
47 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
48 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
55 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
58 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
59 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
60 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
61 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
62 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
63 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
64 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
65 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
66 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
67 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
68 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
72 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
73 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_237089 3300042611 Bacteria 2466
2 Ga0415639_012096 3300038395 Bacteria 10225
3 Ga0415639_014168 3300038395 Bacteria 5637
4 Ga0415639_064266 3300038395 Bacteria 4811
5 Ga0415639_082270 3300038395 Bacteria 5096
6 Ga0466729_217264 3300042621 Bacteria 3647
7 Ga0466709_380446 3300042648 Bacteria 12840
8 Ga0466706_063526 3300042599 Bacteria 4027
9 Ga0466706_067542 3300042599 Bacteria 5956
10 Ga0466706_074539 3300042599 Bacteria 137679
11 Ga0466706_082989 3300042599 Bacteria 2096
12 Ga0466706_266886 3300042599 Bacteria 16888
13 Ga0123355_10309524 3300009826 Bacteria 2143
14 Ga0123355_10474579 3300009826 Bacteria 1560
15 Ga0123355_11559832 3300009826 Bacteria 639
16 Ga0123356_10058552 3300010049 Unclassified 3593
17 Ga0123356_10099736 3300010049 Bacteria 2784
18 Ga0123356_10126164 3300010049 Bacteria 2499
19 Ga0123356_10390121 3300010049 Bacteria 1527
20 Ga0123356_10696530 3300010049 Bacteria 1185
21 Ga0123356_12545261 3300010049 Bacteria 641
22 Ga0123353_10238139 3300010167 Bacteria 2830
23 2227156384 2225789004 Bacteria 1569
24 2227470286 2225789004 Bacteria 930
25 2227510758 2225789004 Bacteria 18314
26 Ga0072940_1244705 3300005200 Bacteria 3173
27 Ga0466733_033553 3300042659 Bacteria 9492
28 Ga0466733_055980 3300042659 Bacteria 2613
29 Ga0255809_1002985 3300022820 Bacteria 1039
30 Ga0466715_066602 3300042616 Bacteria 1754
31 Ga0466715_461636 3300042616 Bacteria 2604
32 Ga0466701_032858 3300042598 Bacteria 7608
33 Ga0466706_018151 3300042599 Bacteria 8219
34 Ga0466706_161210 3300042599 Bacteria 1263
35 Ga0466706_167360 3300042599 Bacteria 14552
36 Ga0466706_176409 3300042599 Unclassified 4136
37 Ga0466706_234606 3300042599 Bacteria 15733
38 Ga0466714_118149 3300042603 Bacteria 1859
39 Ga0466719_396528 3300042606 Bacteria 39186
40 Ga0466721_369751 3300042608 Unclassified 1293
41 Ga0123355_10177089 3300009826 Unclassified 3174
42 Ga0123355_10532318 3300009826 Unclassified 1431
43 Ga0123356_10039472 3300010049 Bacteria 4398
44 Ga0123356_10062074 3300010049 Unclassified 3491
45 Ga0123356_10074798 3300010049 Bacteria 3189
46 Ga0123353_13111968 3300010167 Bacteria 534
47 2227574937 2225789004 Bacteria 2573
48 IMNBL1DRAFT_c0000176 3300000062 Bacteria 57744
49 JGI24696J40584_12786370 3300002834 Bacteria 845
50 Ga0072940_1053452 3300005200 Bacteria 6988
51 Ga0072940_1569268 3300005200 Bacteria 1050
52 Ga0233288_1041084 3300022232 Unclassified 671
53 Ga0415639_001256 3300038395 Bacteria 8514
54 Ga0466706_091306 3300042599 Unclassified 1691
55 Ga0466706_098318 3300042599 Bacteria 11745
56 Ga0466706_119116 3300042599 Unclassified 26716
57 Ga0466706_196280 3300042599 Bacteria 9735
58 Ga0466721_242886 3300042608 Bacteria 103126
59 Ga0123356_13250381 3300010049 Bacteria 565
60 Ga0123353_10001153 3300010167 Bacteria 32224
61 Ga0123353_13108355 3300010167 Bacteria 534
62 Ga0123354_10668115 3300010882 Bacteria 736
63 2227463536 2225789004 Bacteria 25096
64 IMNBL1DRAFT_c0001064 3300000062 Bacteria 21175
65 IMNBL1DRAFT_c0059974 3300000062 Bacteria 1149
66 AustNasuHG_c1000039 3300000089 Bacteria 32381
67 Ga0415639_011076 3300038395 Bacteria 32364
68 Ga0415639_016697 3300038395 Bacteria 1082
69 Ga0415639_091869 3300038395 Bacteria 11535
70 Ga0466690_262098 3300042590 Bacteria 18620
71 Ga0466703_159558 3300042636 Bacteria 7979
72 Ga0466727_237015 3300042655 Bacteria 7524
73 Ga0466715_024120 3300042616 Bacteria 9135
74 Ga0466706_164052 3300042599 Bacteria 208763
75 Ga0466700_131479 3300042600 Bacteria 1340
76 Ga0466714_077115 3300042603 Unclassified 1174
77 Ga0123355_10687689 3300009826 Bacteria 1179
78 Ga0123356_10177650 3300010049 Unclassified 2147
79 Ga0123356_10989780 3300010049 Bacteria 1011
80 Ga0123356_11246225 3300010049 Bacteria 909
81 Ga0123356_11738437 3300010049 Bacteria 774
82 Ga0123356_12299456 3300010049 Bacteria 674
83 Ga0123353_10021205 3300010167 Bacteria 9744
84 Ga0123353_10036212 3300010167 Bacteria 7728
85 Ga0123353_10404416 3300010167 Bacteria 2030
86 Ga0123353_11708041 3300010167 Bacteria 788
87 Ga0123353_12042644 3300010167 Bacteria 700
88 Ga0123353_12164735 3300010167 Bacteria 674
89 Ga0123353_13119374 3300010167 Unclassified 533
90 IMNBL1DRAFT_c0004699 3300000062 Bacteria 8091
91 IMNBL1DRAFT_c0070456 3300000062 Bacteria 1011
92 JGI24696J40584_12912027 3300002834 Bacteria 1264
93 JGI24696J40584_12913138 3300002834 Bacteria 1273
94 Ga0466733_222997 3300042659 Bacteria 5013
95 Ga0223686_1113378 3300021244 Bacteria 527
96 Ga0415639_005486 3300038395 Bacteria 16663
97 Ga0415639_068569 3300038395 Bacteria 7254
98 Ga0466657_134175 3300042582 Unclassified 1166
99 Ga0466695_366833 3300042595 Bacteria 1011
100 Ga0466702_227387 3300042635 Bacteria 1841
101 Ga0466715_304593 3300042616 Bacteria 19244
102 Ga0466726_129962 3300042619 Bacteria 1020
103 Ga0466706_002042 3300042599 Unclassified 3314
104 Ga0466706_028090 3300042599 Unclassified 15118
105 Ga0466714_008537 3300042603 Bacteria 1290
106 Ga0466714_034529 3300042603 Bacteria 1842
107 Ga0466717_070302 3300042604 Bacteria 1088
108 Ga0466716_461341 3300042605 Bacteria 12280
109 Ga0123355_10247677 3300009826 Bacteria 2514
110 Ga0123355_10702684 3300009826 Bacteria 1160
111 Ga0123355_10839684 3300009826 Bacteria 1014
112 Ga0123355_11515507 3300009826 Bacteria 653
113 Ga0123356_10000410 3300010049 Bacteria 48837
114 Ga0123356_10457822 3300010049 Unclassified 1425
115 Ga0123356_10795567 3300010049 Bacteria 1117
116 Ga0123356_11415659 3300010049 Bacteria 855
117 Ga0123356_11786760 3300010049 Bacteria 764
118 Ga0123356_11890125 3300010049 Bacteria 743
119 Ga0123356_13952321 3300010049 Bacteria 511
120 Ga0123353_10134311 3300010167 Bacteria 3969
121 Ga0123353_11172610 3300010167 Bacteria 1011
122 Ga0123353_12288748 3300010167 Bacteria 650
123 2227086407 2225789004 Bacteria 1853
124 2227398870 2225789004 Bacteria 1075
125 2227516035 2225789004 Unclassified 3441
126 2227535717 2225789004 Bacteria 61861
127 IMNBL1DRAFT_c0008955 3300000062 Bacteria 5031
128 IMNBL1DRAFT_c0021751 3300000062 Bacteria 2557
129 IMNBL1DRAFT_c0069815 3300000062 Unclassified 1018
130 JGI24696J40584_12890858 3300002834 Bacteria 1130
131 Ga0415639_003479 3300038395 Bacteria 36121
132 Ga0466731_214303 3300042622 Unclassified 1268
133 Ga0466702_091161 3300042635 Bacteria 3029
134 Ga0466703_235525 3300042636 Bacteria 1576
135 Ga0466715_551549 3300042616 Bacteria 80655
136 Ga0466706_002273 3300042599 Unclassified 1000
137 Ga0466706_095458 3300042599 Bacteria 10297
138 Ga0466706_144155 3300042599 Bacteria 1811
139 Ga0466706_192355 3300042599 Bacteria 16143
140 Ga0466706_220931 3300042599 Bacteria 2216
141 Ga0466706_265792 3300042599 Unclassified 2596
142 Ga0466721_314258 3300042608 Bacteria 1168
143 Ga0123355_10373454 3300009826 Bacteria 1865
144 Ga0123355_11366266 3300009826 Bacteria 704
145 Ga0123356_10044121 3300010049 Bacteria 4150
146 Ga0123356_11861551 3300010049 Bacteria 749
147 Ga0123353_10039157 3300010167 Bacteria 7458
148 Ga0123353_10678108 3300010167 Bacteria 1452
149 Ga0123353_10786527 3300010167 Bacteria 1317
150 Ga0123353_11971437 3300010167 Unclassified 717
151 IMNBL1DRAFT_c0011020 3300000062 Bacteria 4262
152 Ga0466705_271752 3300042612 Bacteria 1904
153 Ga0466733_104878 3300042659 Bacteria 2371
154 Ga0415639_027530 3300038395 Bacteria 2946
155 Ga0466690_241911 3300042590 Bacteria 5520
156 Ga0466696_198426 3300042596 Bacteria 1154
157 Ga0466706_149408 3300042599 Bacteria 15877
158 Ga0466706_234678 3300042599 Bacteria 2478
159 Ga0466717_001487 3300042604 Bacteria 1049
160 Ga0123356_10013460 3300010049 Bacteria 7894
161 Ga0123356_11938195 3300010049 Bacteria 734
162 Ga0123353_10221318 3300010167 Bacteria 2959
163 Ga0123353_11361051 3300010167 Unclassified 916
164 Ga0123353_11367949 3300010167 Bacteria 913
165 Ga0123353_11532119 3300010167 Bacteria 847
166 Ga0123353_11761794 3300010167 Unclassified 772
167 Ga0123354_10112325 3300010882 Bacteria 3588
168 Ga0123354_10331146 3300010882 Bacteria 1388
169 IMNBL1DRAFT_c0001789 3300000062 Bacteria 15722
170 IMNBL1DRAFT_c0008925 3300000062 Bacteria 5042
171 JGI24703J35330_11747780 3300002501 Bacteria 8226
172 Ga0466733_031011 3300042659 Bacteria 1049
173 Ga0466733_167793 3300042659 Bacteria 2323
174 Ga0415639_001314 3300038395 Bacteria 43222
175 Ga0415639_058784 3300038395 Bacteria 1688
176 Ga0415639_119683 3300038395 Bacteria 1131
177 Ga0466702_035014 3300042635 Bacteria 1176
178 Ga0466711_256081 3300042615 Bacteria 17567
179 Ga0466715_494147 3300042616 Unclassified 1111
180 Ga0466726_247531 3300042619 Bacteria 2674
181 Ga0466701_072981 3300042598 Bacteria 1695
182 Ga0466706_018097 3300042599 Unclassified 6136
183 Ga0466706_028292 3300042599 Bacteria 24895
184 Ga0466706_070745 3300042599 Unclassified 2005
185 Ga0466706_072604 3300042599 Bacteria 10680
186 Ga0466706_140515 3300042599 Bacteria 24493
187 Ga0123355_10599454 3300009826 Bacteria 1308
188 Ga0123355_11169092 3300009826 Bacteria 790
189 Ga0123355_11202219 3300009826 Bacteria 774
190 Ga0123356_10045232 3300010049 Bacteria 4096
191 Ga0123356_11702129 3300010049 Unclassified 782
192 Ga0123356_12242053 3300010049 Bacteria 683
193 Ga0123353_10299783 3300010167 Bacteria 2454
194 2227465210 2225789004 Unclassified 5197
195 IMNBL1DRAFT_c0014564 3300000062 Unclassified 3462
196 JGI24702J35022_10011441 3300002462 Bacteria 4944

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_266886 Ga0466706_266886_13716_14066 116
2 3300042636 Ga0466703_159558 Ga0466703_159558_6481_6831 116
3 iso_pr_bacteria 2820342392 2820344249 116
4 2225789004 2227156384 2227564289 117
5 2225789004 2227398870 2227842443 117
6 2225789004 2227465210 2227903034 117
7 2225789004 2227470286 2227915167 117
8 2225789004 2227535717 2228051669 117
9 2225789004 2227574937 2228122843 117
10 3300010049 Ga0123356_10126164 Ga0123356_101261642 117
11 3300021244 Ga0223686_1113378 Ga0223686_11133782 117
12 3300022232 Ga0233288_1041084 Ga0233288_10410841 117
13 3300022820 Ga0255809_1002985 Ga0255809_10029853 117
14 3300038395 Ga0415639_001256 Ga0415639_001256_7455_7808 117
15 3300038395 Ga0415639_001314 Ga0415639_001314_24429_24782 117
16 3300038395 Ga0415639_003479 Ga0415639_003479_24122_24475 117
17 3300038395 Ga0415639_005486 Ga0415639_005486_5040_5393 117
18 3300038395 Ga0415639_012096 Ga0415639_012096_7162_7515 117
19 3300038395 Ga0415639_014168 Ga0415639_014168_2137_2490 117
20 3300038395 Ga0415639_016697 Ga0415639_016697_28_381 117
21 3300038395 Ga0415639_058784 Ga0415639_058784_486_839 117
22 3300038395 Ga0415639_064266 Ga0415639_064266_2952_3305 117
23 3300038395 Ga0415639_068569 Ga0415639_068569_5212_5565 117
24 3300038395 Ga0415639_082270 Ga0415639_082270_3608_3961 117
25 3300038395 Ga0415639_091869 Ga0415639_091869_10262_10615 117
26 3300038395 Ga0415639_119683 Ga0415639_119683_503_856 117
27 3300042582 Ga0466657_134175 Ga0466657_134175_82_435 117
28 3300042595 Ga0466695_366833 Ga0466695_366833_490_843 117
29 3300042596 Ga0466696_198426 Ga0466696_198426_597_950 117
30 3300042598 Ga0466701_032858 Ga0466701_032858_806_1159 117
31 3300042598 Ga0466701_072981 Ga0466701_072981_257_610 117
32 3300042599 Ga0466706_002042 Ga0466706_002042_2918_3271 117
33 3300042599 Ga0466706_002273 Ga0466706_002273_125_478 117
34 3300042599 Ga0466706_018097 Ga0466706_018097_2197_2550 117
35 3300042599 Ga0466706_018151 Ga0466706_018151_6855_7208 117
36 3300042599 Ga0466706_028090 Ga0466706_028090_233_586 117
37 3300042599 Ga0466706_028292 Ga0466706_028292_1078_1431 117
38 3300042599 Ga0466706_067542 Ga0466706_067542_810_1163 117
39 3300042599 Ga0466706_070745 Ga0466706_070745_393_746 117
40 3300042599 Ga0466706_072604 Ga0466706_072604_3679_4032 117
41 3300042599 Ga0466706_074539 Ga0466706_074539_17067_17420 117
42 3300042599 Ga0466706_082989 Ga0466706_082989_360_713 117
43 3300042599 Ga0466706_095458 Ga0466706_095458_33_386 117
44 3300042599 Ga0466706_098318 Ga0466706_098318_6245_6598 117
45 3300042599 Ga0466706_119116 Ga0466706_119116_23881_24234 117
46 3300042599 Ga0466706_140515 Ga0466706_140515_14829_15182 117
47 3300042599 Ga0466706_144155 Ga0466706_144155_280_633 117
48 3300042599 Ga0466706_164052 Ga0466706_164052_141851_142204 117
49 3300042599 Ga0466706_167360 Ga0466706_167360_7923_8276 117
50 3300042599 Ga0466706_176409 Ga0466706_176409_2740_3093 117
51 3300042599 Ga0466706_192355 Ga0466706_192355_5819_6172 117
52 3300042599 Ga0466706_196280 Ga0466706_196280_6992_7345 117
53 3300042599 Ga0466706_220931 Ga0466706_220931_910_1263 117
54 3300042599 Ga0466706_234606 Ga0466706_234606_6306_6659 117
55 3300042599 Ga0466706_234678 Ga0466706_234678_935_1288 117
56 3300042599 Ga0466706_265792 Ga0466706_265792_14_367 117
57 3300042600 Ga0466700_131479 Ga0466700_131479_81_434 117
58 3300042603 Ga0466714_008537 Ga0466714_008537_859_1212 117
59 3300042603 Ga0466714_034529 Ga0466714_034529_13_366 117
60 3300042603 Ga0466714_077115 Ga0466714_077115_224_577 117
61 3300042604 Ga0466717_001487 Ga0466717_001487_32_385 117
62 3300042604 Ga0466717_070302 Ga0466717_070302_176_529 117
63 3300042605 Ga0466716_461341 Ga0466716_461341_3455_3808 117
64 3300042608 Ga0466721_242886 Ga0466721_242886_28510_28863 117
65 3300042608 Ga0466721_314258 Ga0466721_314258_305_658 117
66 3300042608 Ga0466721_369751 Ga0466721_369751_859_1212 117
67 3300042611 Ga0466697_237089 Ga0466697_237089_649_1002 117
68 3300042615 Ga0466711_256081 Ga0466711_256081_10452_10805 117
69 3300042616 Ga0466715_304593 Ga0466715_304593_16761_17114 117
70 3300042616 Ga0466715_551549 Ga0466715_551549_17501_17854 117
71 3300042622 Ga0466731_214303 Ga0466731_214303_519_872 117
72 3300042635 Ga0466702_091161 Ga0466702_091161_891_1244 117
73 3300042636 Ga0466703_235525 Ga0466703_235525_389_742 117
74 3300042648 Ga0466709_380446 Ga0466709_380446_11279_11632 117
75 3300042655 Ga0466727_237015 Ga0466727_237015_2962_3315 117
76 3300042659 Ga0466733_104878 Ga0466733_104878_887_1240 117
77 3300042659 Ga0466733_167793 Ga0466733_167793_593_946 117
78 3300042659 Ga0466733_222997 Ga0466733_222997_1265_1618 117
79 iso_pr_bacteria 2820229114 2820230215 117
80 iso_pr_bacteria 2820244222 2820246175 117
81 iso_pr_bacteria 2820252425 2820254028 117
82 iso_pr_bacteria 2820254385 2820255046 117
83 iso_pr_bacteria 2820255904 2820257028 117
84 iso_pr_bacteria 2820272499 2820273002 117
85 iso_pr_bacteria 2820280018 2820280081 117
86 iso_pr_bacteria 2820288918 2820289344 117
87 iso_pr_bacteria 2820294436 2820295090 117
88 iso_pr_bacteria 2820321184 2820321900 117
89 iso_pr_bacteria 2820336130 2820336269 117
90 iso_pr_bacteria 2820339298 2820340034 117
91 iso_pr_bacteria 2820360414 2820361392 117
92 iso_pr_bacteria 2820362221 2820364031 117
93 iso_pr_bacteria 2820373881 2820374707 117
94 iso_pr_bacteria 2820387566 2820387775 117
95 iso_pr_bacteria 2820420508 2820421663 117
96 iso_pr_bacteria 2820453354 2820454728 117
97 iso_pr_bacteria 2820463629 2820464481 117
98 iso_pr_bacteria 2820464928 2820465752 117
99 iso_pr_bacteria 2820483401 2820483916 117
100 iso_pr_bacteria 2820504582 2820505438 117
101 iso_pr_bacteria 2820551407 2820552508 117
102 iso_pr_bacteria 2820560510 2820560854 117
103 iso_pr_bacteria 2820570671 2820572442 117
104 iso_pr_bacteria 2820576413 2820576532 117
105 2225789004 2227086407 2227463444 118
106 2225789004 2227463536 2227899235 118
107 2225789004 2227510758 2228004854 118
108 3300000062 IMNBL1DRAFT_c0000176 IMNBL1DRAFT_000017643 118
109 3300000062 IMNBL1DRAFT_c0004699 IMNBL1DRAFT_00046998 118
110 3300000062 IMNBL1DRAFT_c0008925 IMNBL1DRAFT_00089255 118
111 3300000062 IMNBL1DRAFT_c0008955 IMNBL1DRAFT_00089552 118
112 3300000062 IMNBL1DRAFT_c0021751 IMNBL1DRAFT_00217513 118
113 3300000062 IMNBL1DRAFT_c0069815 IMNBL1DRAFT_00698153 118
114 3300000089 AustNasuHG_c1000039 AustNasuHG_10000396 118
115 3300002462 JGI24702J35022_10011441 JGI24702J35022_100114413 118
116 3300002501 JGI24703J35330_11747780 JGI24703J35330_117477805 118
117 3300002834 JGI24696J40584_12786370 JGI24696J40584_127863701 118
118 3300002834 JGI24696J40584_12890858 JGI24696J40584_128908583 118
119 3300002834 JGI24696J40584_12912027 JGI24696J40584_129120273 118
120 3300002834 JGI24696J40584_12913138 JGI24696J40584_129131383 118
121 3300005200 Ga0072940_1053452 Ga0072940_105345210 118
122 3300005200 Ga0072940_1244705 Ga0072940_12447054 118
123 3300009826 Ga0123355_10177089 Ga0123355_101770893 118
124 3300009826 Ga0123355_10247677 Ga0123355_102476771 118
125 3300009826 Ga0123355_10474579 Ga0123355_104745793 118
126 3300009826 Ga0123355_10532318 Ga0123355_105323181 118
127 3300009826 Ga0123355_10599454 Ga0123355_105994542 118
128 3300009826 Ga0123355_10687689 Ga0123355_106876891 118
129 3300009826 Ga0123355_10702684 Ga0123355_107026842 118
130 3300009826 Ga0123355_10839684 Ga0123355_108396842 118
131 3300009826 Ga0123355_11169092 Ga0123355_111690922 118
132 3300009826 Ga0123355_11202219 Ga0123355_112022191 118
133 3300009826 Ga0123355_11515507 Ga0123355_115155071 118
134 3300010049 Ga0123356_10000410 Ga0123356_1000041022 118
135 3300010049 Ga0123356_10044121 Ga0123356_100441215 118
136 3300010049 Ga0123356_10058552 Ga0123356_100585523 118
137 3300010049 Ga0123356_10062074 Ga0123356_100620743 118
138 3300010049 Ga0123356_10074798 Ga0123356_100747982 118
139 3300010049 Ga0123356_10099736 Ga0123356_100997363 118
140 3300010049 Ga0123356_10457822 Ga0123356_104578222 118
141 3300010049 Ga0123356_10795567 Ga0123356_107955671 118
142 3300010049 Ga0123356_10989780 Ga0123356_109897802 118
143 3300010049 Ga0123356_11246225 Ga0123356_112462251 118
144 3300010049 Ga0123356_11702129 Ga0123356_117021291 118
145 3300010049 Ga0123356_11786760 Ga0123356_117867601 118
146 3300010049 Ga0123356_11861551 Ga0123356_118615512 118
147 3300010049 Ga0123356_11890125 Ga0123356_118901251 118
148 3300010049 Ga0123356_12299456 Ga0123356_122994562 118
149 3300010049 Ga0123356_12545261 Ga0123356_125452612 118
150 3300010049 Ga0123356_13250381 Ga0123356_132503811 118
151 3300010049 Ga0123356_13952321 Ga0123356_139523211 118
152 3300010167 Ga0123353_10001153 Ga0123353_1000115317 118
153 3300010167 Ga0123353_10036212 Ga0123353_1003621210 118
154 3300010167 Ga0123353_10039157 Ga0123353_100391575 118
155 3300010167 Ga0123353_10221318 Ga0123353_102213181 118
156 3300010167 Ga0123353_10238139 Ga0123353_102381393 118
157 3300010167 Ga0123353_10678108 Ga0123353_106781082 118
158 3300010167 Ga0123353_10786527 Ga0123353_107865272 118
159 3300010167 Ga0123353_11172610 Ga0123353_111726101 118
160 3300010167 Ga0123353_11367949 Ga0123353_113679492 118
161 3300010167 Ga0123353_11761794 Ga0123353_117617941 118
162 3300010167 Ga0123353_11971437 Ga0123353_119714372 118
163 3300010167 Ga0123353_12042644 Ga0123353_120426441 118
164 3300010167 Ga0123353_12164735 Ga0123353_121647352 118
165 3300010167 Ga0123353_13108355 Ga0123353_131083551 118
166 3300010167 Ga0123353_13111968 Ga0123353_131119681 118
167 3300010167 Ga0123353_13119374 Ga0123353_131193741 118
168 3300010882 Ga0123354_10112325 Ga0123354_101123254 118
169 3300010882 Ga0123354_10331146 Ga0123354_103311462 118
170 3300038395 Ga0415639_011076 Ga0415639_011076_11361_11717 118
171 3300038395 Ga0415639_027530 Ga0415639_027530_127_483 118
172 3300042599 Ga0466706_063526 Ga0466706_063526_300_656 118
173 3300042599 Ga0466706_091306 Ga0466706_091306_676_1032 118
174 3300042599 Ga0466706_149408 Ga0466706_149408_6903_7259 118
175 3300042599 Ga0466706_161210 Ga0466706_161210_70_426 118
176 3300042603 Ga0466714_118149 Ga0466714_118149_1121_1477 118
177 3300042635 Ga0466702_035014 Ga0466702_035014_28_384 118
178 3300042635 Ga0466702_227387 Ga0466702_227387_540_896 118
179 3300042659 Ga0466733_033553 Ga0466733_033553_5768_6124 118
180 3300042659 Ga0466733_055980 Ga0466733_055980_1605_1961 118
181 iso_pr_bacteria 2820250282 2820250443 118
182 iso_pr_bacteria 2820265624 2820265861 118
183 iso_pr_bacteria 2820348946 2820349428 118
184 iso_pr_bacteria 2820460928 2820461090 118
185 iso_pr_bacteria 2820488713 2820490215 118
186 iso_pr_bacteria 2820516196 2820517798 118
187 iso_pr_bacteria 2820546020 2820547068 118
188 2225789004 2227516035 2228014767 119
189 3300000062 IMNBL1DRAFT_c0001789 IMNBL1DRAFT_00017895 119
190 3300000062 IMNBL1DRAFT_c0011020 IMNBL1DRAFT_00110202 119
191 3300000062 IMNBL1DRAFT_c0014564 IMNBL1DRAFT_00145642 119
192 3300000062 IMNBL1DRAFT_c0070456 IMNBL1DRAFT_00704562 119
193 3300009826 Ga0123355_10309524 Ga0123355_103095243 119
194 3300009826 Ga0123355_10373454 Ga0123355_103734541 119
195 3300009826 Ga0123355_11366266 Ga0123355_113662662 119
196 3300009826 Ga0123355_11559832 Ga0123355_115598322 119
197 3300010049 Ga0123356_10039472 Ga0123356_100394723 119
198 3300010049 Ga0123356_10045232 Ga0123356_100452322 119
199 3300010049 Ga0123356_10177650 Ga0123356_101776501 119
200 3300010049 Ga0123356_10390121 Ga0123356_103901213 119
201 3300010049 Ga0123356_10696530 Ga0123356_106965303 119
202 3300010049 Ga0123356_11415659 Ga0123356_114156591 119
203 3300010049 Ga0123356_11738437 Ga0123356_117384372 119
204 3300010049 Ga0123356_11938195 Ga0123356_119381951 119
205 3300010167 Ga0123353_10021205 Ga0123353_1002120510 119
206 3300010167 Ga0123353_10134311 Ga0123353_101343112 119
207 3300010167 Ga0123353_10299783 Ga0123353_102997834 119
208 3300010167 Ga0123353_10404416 Ga0123353_104044163 119
209 3300010167 Ga0123353_11361051 Ga0123353_113610512 119
210 3300010167 Ga0123353_11532119 Ga0123353_115321192 119
211 3300010167 Ga0123353_11708041 Ga0123353_117080412 119
212 3300010167 Ga0123353_12288748 Ga0123353_122887482 119
213 3300042590 Ga0466690_262098 Ga0466690_262098_14615_14974 119
214 3300042606 Ga0466719_396528 Ga0466719_396528_36708_37067 119
215 3300042616 Ga0466715_024120 Ga0466715_024120_2626_2985 119
216 3300042616 Ga0466715_066602 Ga0466715_066602_1046_1405 119
217 3300042616 Ga0466715_461636 Ga0466715_461636_1169_1528 119
218 3300042619 Ga0466726_247531 Ga0466726_247531_1183_1542 119
219 3300000062 IMNBL1DRAFT_c0001064 IMNBL1DRAFT_000106417 120
220 3300000062 IMNBL1DRAFT_c0059974 IMNBL1DRAFT_00599742 120
221 3300010049 Ga0123356_10013460 Ga0123356_100134609 120
222 3300010049 Ga0123356_12242053 Ga0123356_122420531 120
223 3300042659 Ga0466733_031011 Ga0466733_031011_410_772 120
224 3300042619 Ga0466726_129962 Ga0466726_129962_46_414 122
225 3300005200 Ga0072940_1569268 Ga0072940_15692681 124
226 3300010882 Ga0123354_10668115 Ga0123354_106681151 126
227 3300042590 Ga0466690_241911 Ga0466690_241911_1759_2142 127
228 3300042621 Ga0466729_217264 Ga0466729_217264_1372_1758 128
229 3300042616 Ga0466715_494147 Ga0466715_494147_12_401 129
230 3300042612 Ga0466705_271752 Ga0466705_271752_1109_1546 145

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00453 Ribosomal_L20 Ribosomal protein L20 3 109 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.