Protein Family IF01232
Metagenome
Isolate
167
Members
89
Samples
148
Scaffolds
129.75
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1016329|Ga0072940_10163293
- Length
- 147 aa
- Sequence
- MKLLLDTHLLLWAAAGTLPKKAKELITDEKNVLLFSAASIWEIVIKNGLNRQDFQVDAFMLHNGLLNNGYVEVAIDAYHSLYIGKLPLIHKDPFDRILVAQAQQEKATLLTCDKILTDYPCSIIYIKPPKRASRVKITFGLTKYLG*
Sample Types
Isolate
11.4%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.6%
Unclassified
20.7%
Formicidae
18.4%
Kalotermitidae
12.6%
Aphididae
3.4%
Termopsidae
3.4%
Daphniidae
1.1%
Hodotermitidae
1.1%
Rhinotermitidae
1.1%
Siricidae
1.1%
Drosophilidae
1.1%
Taxonomy
Archaea
1
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 2 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 3 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 4 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 13 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 18 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 19 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 22 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 23 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 29 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 30 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 31 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 51 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 60 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 61 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 62 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 63 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 64 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 68 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 69 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 70 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 71 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 72 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 73 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 74 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 75 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 76 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 77 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 78 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 79 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 80 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 81 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 82 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 83 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 84 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 85 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 86 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 87 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 88 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 89 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466725_009950 | 3300042654 | Bacteria | 52916 |
| 2 | Ga0466725_435738 | 3300042654 | Bacteria | 1684 |
| 3 | Ga0466718_124779 | 3300042617 | Bacteria | 1017 |
| 4 | Ga0466723_163225 | 3300042618 | Bacteria | 2250 |
| 5 | Ga0466723_306490 | 3300042618 | Bacteria | 16637 |
| 6 | JGI24698J34947_10163788 | 3300002449 | Bacteria | 908 |
| 7 | JGI24705J35276_12235177 | 3300002504 | Unclassified | 6254 |
| 8 | Ga0068305_10040148 | 3300005083 | Bacteria | 8474 |
| 9 | Ga0072941_1040966 | 3300005201 | Bacteria | 4456 |
| 10 | Ga0102739_1001927 | 3300007095 | Bacteria | 3307 |
| 11 | Ga0102738_1022318 | 3300007141 | Bacteria | 913 |
| 12 | Ga0103267_1076058 | 3300007190 | Bacteria | 1021 |
| 13 | Ga0466706_001654 | 3300042599 | Bacteria | 2059 |
| 14 | Ga0466707_247189 | 3300042601 | Bacteria | 129032 |
| 15 | Ga0466719_459088 | 3300042606 | Bacteria | 1322 |
| 16 | Ga0466729_071548 | 3300042621 | Bacteria | 2687 |
| 17 | JGI24703J35330_11748310 | 3300002501 | Bacteria | 13651 |
| 18 | Ga0072941_1002430 | 3300005201 | Bacteria | 32020 |
| 19 | Ga0072941_1037448 | 3300005201 | Unclassified | 5618 |
| 20 | Ga0103263_100378 | 3300007042 | Bacteria | 6149 |
| 21 | Ga0105004_1030201 | 3300007763 | Bacteria | 22575 |
| 22 | Ga0123353_10497777 | 3300010167 | Bacteria | 1777 |
| 23 | Ga0264413_104965 | 3300024493 | Bacteria | 5095 |
| 24 | Ga0466690_068844 | 3300042590 | Bacteria | 4470 |
| 25 | Ga0466691_226023 | 3300042593 | Bacteria | 17113 |
| 26 | Ga0466706_152865 | 3300042599 | Bacteria | 1371 |
| 27 | Ga0466706_190947 | 3300042599 | Bacteria | 8507 |
| 28 | Ga0466707_092759 | 3300042601 | Bacteria | 4335 |
| 29 | Ga0466705_076612 | 3300042612 | Bacteria | 1240 |
| 30 | Ga0466703_269387 | 3300042636 | Bacteria | 13036 |
| 31 | Ga0466703_361545 | 3300042636 | Bacteria | 16605 |
| 32 | Ga0466708_124000 | 3300042652 | Bacteria | 7841 |
| 33 | Ga0466708_302785 | 3300042652 | Bacteria | 29938 |
| 34 | JGI24702J35022_10025310 | 3300002462 | Bacteria | 3203 |
| 35 | JGI24696J40584_12903321 | 3300002834 | Bacteria | 1200 |
| 36 | Ga0072941_1222190 | 3300005201 | Unclassified | 780 |
| 37 | Ga0103266_1004387 | 3300007067 | Bacteria | 1910 |
| 38 | Ga0103265_1000485 | 3300007068 | Bacteria | 7190 |
| 39 | Ga0123357_10440114 | 3300009784 | Bacteria | 1142 |
| 40 | Ga0123356_10918783 | 3300010049 | Bacteria | 1046 |
| 41 | Ga0136159_1000050 | 3300010217 | Bacteria | 23955 |
| 42 | Ga0264413_129909 | 3300024493 | Bacteria | 9058 |
| 43 | Ga0466657_313726 | 3300042582 | Bacteria | 1264 |
| 44 | Ga0466714_126708 | 3300042603 | Bacteria | 1545 |
| 45 | Ga0466717_144490 | 3300042604 | Bacteria | 4389 |
| 46 | Ga0466717_175925 | 3300042604 | Bacteria | 1642 |
| 47 | Ga0466733_097672 | 3300042659 | Bacteria | 14615 |
| 48 | Ga0466704_175195 | 3300042643 | Bacteria | 4352 |
| 49 | Ga0466715_044549 | 3300042616 | Bacteria | 37804 |
| 50 | Ga0466718_015231 | 3300042617 | Bacteria | 4408 |
| 51 | Ga0072941_1066587 | 3300005201 | Unclassified | 1911 |
| 52 | Ga0072941_1265173 | 3300005201 | Bacteria | 1355 |
| 53 | Ga0103266_1002503 | 3300007067 | Bacteria | 2815 |
| 54 | Ga0103266_1061070 | 3300007067 | Bacteria | 504 |
| 55 | Ga0102737_1010762 | 3300007142 | Bacteria | 1533 |
| 56 | Ga0123357_10695157 | 3300009784 | Bacteria | 731 |
| 57 | Ga0123356_10000618 | 3300010049 | Bacteria | 39358 |
| 58 | Ga0264413_125724 | 3300024493 | Bacteria | 4335 |
| 59 | Ga0466657_091516 | 3300042582 | Bacteria | 1915 |
| 60 | Ga0466694_409427 | 3300042594 | Bacteria | 2908 |
| 61 | Ga0466696_335321 | 3300042596 | Bacteria | 4224 |
| 62 | Ga0466699_112185 | 3300042597 | Bacteria | 1268 |
| 63 | Ga0466699_258422 | 3300042597 | Unclassified | 1447 |
| 64 | Ga0466699_327299 | 3300042597 | Unclassified | 1145 |
| 65 | Ga0466717_069482 | 3300042604 | Bacteria | 3129 |
| 66 | Ga0466697_203844 | 3300042611 | Bacteria | 1029 |
| 67 | Ga0466702_456271 | 3300042635 | Unclassified | 1234 |
| 68 | Ga0466726_269447 | 3300042619 | Bacteria | 2086 |
| 69 | JGI24705J35276_12238272 | 3300002504 | Bacteria | 18335 |
| 70 | CVPL010W_10036277 | 3300002931 | Bacteria | 1651 |
| 71 | Ga0072941_1017067 | 3300005201 | Bacteria | 15394 |
| 72 | Ga0074263_143227 | 3300005485 | Bacteria | 816 |
| 73 | Ga0102734_1003371 | 3300007129 | Bacteria | 6311 |
| 74 | Ga0103260_1041058 | 3300007139 | Bacteria | 717 |
| 75 | Ga0102737_1016852 | 3300007142 | Bacteria | 1918 |
| 76 | Ga0103267_1082013 | 3300007190 | Bacteria | 961 |
| 77 | Ga0123355_10138593 | 3300009826 | Bacteria | 3730 |
| 78 | Ga0123355_10868853 | 3300009826 | Bacteria | 988 |
| 79 | Ga0123356_10008775 | 3300010049 | Bacteria | 10018 |
| 80 | Ga0123356_10056116 | 3300010049 | Bacteria | 3669 |
| 81 | Ga0123356_11751872 | 3300010049 | Bacteria | 771 |
| 82 | Ga0123354_10466282 | 3300010882 | Bacteria | 1010 |
| 83 | Ga0466719_291146 | 3300042606 | Bacteria | 1266 |
| 84 | Ga0466698_366535 | 3300042610 | Bacteria | 1700 |
| 85 | Ga0466698_448828 | 3300042610 | Unclassified | 1342 |
| 86 | Ga0466731_379435 | 3300042622 | Archaea | 2270 |
| 87 | Ga0466734_073584 | 3300042623 | Bacteria | 18118 |
| 88 | Ga0466702_348866 | 3300042635 | Bacteria | 3553 |
| 89 | Ga0466710_053645 | 3300042613 | Bacteria | 3429 |
| 90 | Ga0466710_090187 | 3300042613 | Bacteria | 82809 |
| 91 | Ga0466710_338414 | 3300042613 | Bacteria | 1095 |
| 92 | JGI24698J34947_10058773 | 3300002449 | Bacteria | 1903 |
| 93 | Ga0072940_1016329 | 3300005200 | Bacteria | 1334 |
| 94 | Ga0102738_1002828 | 3300007141 | Bacteria | 2567 |
| 95 | Ga0102737_1002938 | 3300007142 | Unclassified | 4058 |
| 96 | Ga0123356_10001948 | 3300010049 | Bacteria | 22353 |
| 97 | Ga0123356_10006577 | 3300010049 | Bacteria | 11711 |
| 98 | Ga0123356_10416471 | 3300010049 | Bacteria | 1484 |
| 99 | Ga0123353_10025269 | 3300010167 | Bacteria | 9046 |
| 100 | Ga0123353_10433804 | 3300010167 | Bacteria | 1941 |
| 101 | Ga0264413_107314 | 3300024493 | Bacteria | 3972 |
| 102 | Ga0466657_377308 | 3300042582 | Bacteria | 5531 |
| 103 | Ga0466696_065327 | 3300042596 | Bacteria | 1679 |
| 104 | Ga0466696_176643 | 3300042596 | Bacteria | 2527 |
| 105 | Ga0466707_031805 | 3300042601 | Bacteria | 5505 |
| 106 | Ga0466707_035762 | 3300042601 | Bacteria | 1010 |
| 107 | Ga0466716_506693 | 3300042605 | Bacteria | 1575 |
| 108 | Ga0466719_074773 | 3300042606 | Bacteria | 5509 |
| 109 | Ga0466721_217031 | 3300042608 | Bacteria | 19316 |
| 110 | Ga0466734_150799 | 3300042623 | Bacteria | 3665 |
| 111 | Ga0466704_280409 | 3300042643 | Bacteria | 3357 |
| 112 | Ga0466708_104150 | 3300042652 | Bacteria | 29160 |
| 113 | SWWA_contig04114__length_900___numreads_14 | 2100351016 | Bacteria | 900 |
| 114 | AustNasuHG_c1016941 | 3300000089 | Bacteria | 2432 |
| 115 | JGI24698J34947_10184979 | 3300002449 | Unclassified | 829 |
| 116 | Ga0102733_100390 | 3300006995 | Bacteria | 2454 |
| 117 | Ga0102736_1000597 | 3300007052 | Bacteria | 7126 |
| 118 | Ga0102735_1007401 | 3300007080 | Bacteria | 2494 |
| 119 | Ga0103261_1013627 | 3300007083 | Unclassified | 1129 |
| 120 | Ga0102739_1002066 | 3300007095 | Bacteria | 3170 |
| 121 | Ga0102734_1008084 | 3300007129 | Bacteria | 2390 |
| 122 | Ga0103268_1016488 | 3300007192 | Bacteria | 1621 |
| 123 | Ga0123355_11293859 | 3300009826 | Unclassified | 732 |
| 124 | Ga0123356_10058831 | 3300010049 | Bacteria | 3584 |
| 125 | Ga0123353_10149101 | 3300010167 | Bacteria | 3736 |
| 126 | Ga0123353_12628701 | 3300010167 | Bacteria | 595 |
| 127 | Ga0466720_000510 | 3300042607 | Bacteria | 1104 |
| 128 | Ga0466733_050179 | 3300042659 | Bacteria | 3274 |
| 129 | Ga0466727_104988 | 3300042655 | Bacteria | 1204 |
| 130 | Ga0466727_179112 | 3300042655 | Bacteria | 1073 |
| 131 | Ga0466712_037809 | 3300042614 | Unclassified | 3173 |
| 132 | Ga0466712_078076 | 3300042614 | Unclassified | 4622 |
| 133 | Ga0466718_023070 | 3300042617 | Bacteria | 1127 |
| 134 | Ga0466718_046435 | 3300042617 | Bacteria | 2089 |
| 135 | JGI24698J34947_10193893 | 3300002449 | Unclassified | 801 |
| 136 | JGI24702J35022_10274818 | 3300002462 | Bacteria | 987 |
| 137 | Ga0068302_10622379 | 3300005071 | Bacteria | 727 |
| 138 | Ga0072941_1015462 | 3300005201 | Bacteria | 14518 |
| 139 | Ga0103264_1016664 | 3300007188 | Unclassified | 3598 |
| 140 | Ga0123353_10000180 | 3300010167 | Bacteria | 80622 |
| 141 | Ga0123353_10713784 | 3300010167 | Bacteria | 1404 |
| 142 | Ga0466657_039948 | 3300042582 | Bacteria | 1887 |
| 143 | Ga0466696_161071 | 3300042596 | Bacteria | 3026 |
| 144 | Ga0466700_066188 | 3300042600 | Bacteria | 1578 |
| 145 | Ga0466707_373109 | 3300042601 | Bacteria | 19213 |
| 146 | Ga0466717_245773 | 3300042604 | Bacteria | 1465 |
| 147 | Ga0466720_039436 | 3300042607 | Bacteria | 9708 |
| 148 | Ga0466698_504631 | 3300042610 | Bacteria | 5301 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 4 | 118 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.