Protein Family IF01208
Metagenome
Isolate
130
Members
63
Samples
112
Scaffolds
109.24
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10234432|Ga0068305_102344324
- Length
- 123 aa
- Sequence
- VEKIAENKELTLKDTQKLVDEWIKTYGVRYFSELTNMAVLTEEVGELARVIARTYGDQSFKKEDLSHSLADEMADVLWVLLCLANQTGVDLTDAFLANIHKKTRRDNVRHQQNEKLKNVPQS*
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.2%
Kalotermitidae
19.4%
Blattidae
17.7%
Unclassified
11.3%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Passalidae
4.8%
Drosophilidae
3.2%
Hydrophilidae
3.2%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 14 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 15 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 22 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300005299 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 1 gut | Metagenome | Drosophilidae |
| 26 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 36 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 42 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 43 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 49 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 50 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 51 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 52 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 55 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 57 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 58 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 59 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 60 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_210608 | 3300042659 | Bacteria | 40939 |
| 2 | Ga0466657_210485 | 3300042582 | Bacteria | 22461 |
| 3 | Ga0466735_234357 | 3300042624 | Bacteria | 1812 |
| 4 | Ga0466708_056965 | 3300042652 | Bacteria | 14666 |
| 5 | Ga0123357_10149123 | 3300009784 | Bacteria | 2845 |
| 6 | Ga0123356_10072688 | 3300010049 | Bacteria | 3232 |
| 7 | Ga0466706_043646 | 3300042599 | Bacteria | 9905 |
| 8 | Ga0466706_254656 | 3300042599 | Bacteria | 4712 |
| 9 | Ga0466733_126709 | 3300042659 | Bacteria | 25436 |
| 10 | Ga0466715_085937 | 3300042616 | Bacteria | 11857 |
| 11 | JGI24702J35022_10056214 | 3300002462 | Bacteria | 2099 |
| 12 | Ga0074146_1012184 | 3300005299 | Bacteria | 1621 |
| 13 | Ga0265387_1016919 | 3300024582 | Bacteria | 1051 |
| 14 | Ga0466692_102274 | 3300042591 | Bacteria | 5109 |
| 15 | Ga0466696_044686 | 3300042596 | Bacteria | 6405 |
| 16 | Ga0466735_113258 | 3300042624 | Bacteria | 1100 |
| 17 | Ga0466735_191563 | 3300042624 | Bacteria | 5729 |
| 18 | Ga0466704_503070 | 3300042643 | Bacteria | 2006 |
| 19 | Ga0466725_039921 | 3300042654 | Bacteria | 2675 |
| 20 | Ga0466706_133021 | 3300042599 | Bacteria | 3265 |
| 21 | Ga0466713_000880 | 3300042602 | Bacteria | 20825 |
| 22 | Ga0466719_065218 | 3300042606 | Bacteria | 22853 |
| 23 | Ga0466698_185422 | 3300042610 | Bacteria | 1378 |
| 24 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 25 | Ga0466705_056487 | 3300042612 | Bacteria | 11616 |
| 26 | Ga0466733_125240 | 3300042659 | Bacteria | 4913 |
| 27 | Ga0466733_150639 | 3300042659 | Bacteria | 185699 |
| 28 | Ga0466733_192833 | 3300042659 | Bacteria | 2209 |
| 29 | Ga0466711_335108 | 3300042615 | Bacteria | 1376 |
| 30 | Ga0466715_140634 | 3300042616 | Bacteria | 1635 |
| 31 | Ga0466726_234425 | 3300042619 | Bacteria | 6071 |
| 32 | 2227631579 | 2225789004 | Bacteria | 2119 |
| 33 | Ga0068302_10101704 | 3300005071 | Bacteria | 4872 |
| 34 | Ga0466690_018936 | 3300042590 | Bacteria | 8628 |
| 35 | Ga0466735_004308 | 3300042624 | Bacteria | 8699 |
| 36 | Ga0466735_128327 | 3300042624 | Bacteria | 3173 |
| 37 | Ga0466730_044603 | 3300042625 | Bacteria | 4878 |
| 38 | Ga0466730_094522 | 3300042625 | Bacteria | 1857 |
| 39 | Ga0466703_079081 | 3300042636 | Bacteria | 8301 |
| 40 | Ga0466703_268275 | 3300042636 | Bacteria | 1867 |
| 41 | Ga0123357_10012499 | 3300009784 | Unclassified | 10956 |
| 42 | Ga0123354_10133205 | 3300010882 | Bacteria | 3126 |
| 43 | Ga0466706_210096 | 3300042599 | Bacteria | 35546 |
| 44 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 45 | Ga0466714_056213 | 3300042603 | Bacteria | 1875 |
| 46 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 47 | Ga0466733_071653 | 3300042659 | Bacteria | 6866 |
| 48 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 49 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 50 | Ga0466728_311604 | 3300042620 | Bacteria | 10551 |
| 51 | IMNBL1DRAFT_c0010863 | 3300000062 | Bacteria | 4308 |
| 52 | Ga0265387_1003611 | 3300024582 | Bacteria | 2124 |
| 53 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 54 | Ga0466729_214354 | 3300042621 | Bacteria | 4455 |
| 55 | Ga0466735_023878 | 3300042624 | Bacteria | 1209 |
| 56 | Ga0466703_038398 | 3300042636 | Bacteria | 12958 |
| 57 | Ga0466725_194480 | 3300042654 | Bacteria | 6695 |
| 58 | Ga0466727_115723 | 3300042655 | Bacteria | 2065 |
| 59 | Ga0466701_092879 | 3300042598 | Bacteria | 8782 |
| 60 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 61 | Ga0466706_180415 | 3300042599 | Bacteria | 1010 |
| 62 | Ga0466707_136654 | 3300042601 | Bacteria | 15946 |
| 63 | Ga0466707_144321 | 3300042601 | Bacteria | 17726 |
| 64 | Ga0466713_066220 | 3300042602 | Bacteria | 1228 |
| 65 | Ga0466714_156697 | 3300042603 | Bacteria | 1896 |
| 66 | Ga0466722_052256 | 3300042609 | Bacteria | 7178 |
| 67 | Ga0466733_093205 | 3300042659 | Bacteria | 6293 |
| 68 | Ga0466710_174404 | 3300042613 | Bacteria | 6957 |
| 69 | Ga0466711_070021 | 3300042615 | Bacteria | 21814 |
| 70 | Ga0466715_175518 | 3300042616 | Bacteria | 23921 |
| 71 | Ga0466723_123771 | 3300042618 | Bacteria | 12843 |
| 72 | Ga0466726_060416 | 3300042619 | Unclassified | 1172 |
| 73 | IMNBL1DRAFT_c0000175 | 3300000062 | Bacteria | 57822 |
| 74 | JGI24699J35502_11134229 | 3300002509 | Bacteria | 98606 |
| 75 | Ga0466696_239113 | 3300042596 | Bacteria | 9395 |
| 76 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 77 | Ga0466735_088715 | 3300042624 | Bacteria | 1353 |
| 78 | Ga0123357_10542749 | 3300009784 | Bacteria | 933 |
| 79 | Ga0466722_227975 | 3300042609 | Bacteria | 13095 |
| 80 | Ga0466733_054545 | 3300042659 | Bacteria | 1055 |
| 81 | Ga0466711_244271 | 3300042615 | Bacteria | 4718 |
| 82 | Ga0068305_10234432 | 3300005083 | Bacteria | 4781 |
| 83 | Ga0466696_057309 | 3300042596 | Bacteria | 8007 |
| 84 | Ga0466734_122583 | 3300042623 | Bacteria | 1617 |
| 85 | Ga0466707_072525 | 3300042601 | Bacteria | 13511 |
| 86 | Ga0466705_291938 | 3300042612 | Bacteria | 2066 |
| 87 | Ga0466710_078446 | 3300042613 | Bacteria | 7785 |
| 88 | Ga0466710_429230 | 3300042613 | Bacteria | 1478 |
| 89 | Ga0466715_217509 | 3300042616 | Bacteria | 7111 |
| 90 | IMNBL1DRAFT_c0000335 | 3300000062 | Bacteria | 39826 |
| 91 | IMNBL1DRAFT_c0003440 | 3300000062 | Bacteria | 10186 |
| 92 | IMNBL1DRAFT_c0015170 | 3300000062 | Bacteria | 3353 |
| 93 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 94 | Ga0466690_185737 | 3300042590 | Bacteria | 33974 |
| 95 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 96 | Ga0466729_219149 | 3300042621 | Bacteria | 1745 |
| 97 | Ga0466735_132024 | 3300042624 | Bacteria | 7960 |
| 98 | Ga0466706_032825 | 3300042599 | Bacteria | 47486 |
| 99 | Ga0466706_098015 | 3300042599 | Bacteria | 58460 |
| 100 | Ga0466716_435464 | 3300042605 | Bacteria | 6362 |
| 101 | Ga0466710_413770 | 3300042613 | Bacteria | 1256 |
| 102 | IMNBGM34_c019322 | 3300000036 | Bacteria | 853 |
| 103 | IMNBGM34_c041106 | 3300000036 | Bacteria | 598 |
| 104 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 105 | IMNBL1DRAFT_c0162862 | 3300000062 | Bacteria | 569 |
| 106 | Ga0104042_1129066 | 3300007130 | Bacteria | 1048 |
| 107 | Ga0466696_030088 | 3300042596 | Bacteria | 9675 |
| 108 | Ga0466735_031351 | 3300042624 | Bacteria | 11211 |
| 109 | Ga0466727_282753 | 3300042655 | Bacteria | 2592 |
| 110 | Ga0466707_012465 | 3300042601 | Bacteria | 1444 |
| 111 | Ga0466713_147122 | 3300042602 | Bacteria | 45505 |
| 112 | Ga0466716_305771 | 3300042605 | Bacteria | 2470 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.