Protein Family IF01195
Metagenome
Isolate
125
Members
58
Samples
117
Scaffolds
339.84
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10074950|Ga0068305_100749507
- Length
- 379 aa
- Sequence
- MPITNPKIQQPDFRQLVEILPAQIQPTVSVKSENPNNAVVTDISTNGYNRMLREIIAEVKXNRLNTSVIQLYWNIGKILSAEKLEKGYGGKVVERLSLDLKIEFPDKDGFSPRSLWDMKRLYEFYSNDDEILPQSVAVSQNQIPPQPVAVLGWGHNRLILNKIKDKQEALYYAEAAVKMGWTRDLLLNFIKADAYHNAQELPKLHNFDNALPEHLQKQATEMLKATYNLGFLDLRFPIKELELERRLVEKIKLFLLELGEGFTFIGNQHRLTFNNKEYFVDLLFFNRKVKSLIAIDLKISAFKPEYVGKMNYYLGLLDDRMKMPDENPSIGIILCAEKDHIEVEIALRDFHKPIGVAEYQTIFPEKEIKNMINRELNK*
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.2%
Kalotermitidae
21.4%
Unclassified
19.6%
Termopsidae
5.4%
Rhinotermitidae
1.8%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
1
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 23 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 24 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 25 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_130036 | 3300042611 | Bacteria | 1508 |
| 2 | Ga0466705_070463 | 3300042612 | Bacteria | 4954 |
| 3 | Ga0466656_309884 | 3300042550 | Bacteria | 1019 |
| 4 | Ga0466692_152545 | 3300042591 | Bacteria | 10387 |
| 5 | Ga0123353_10235615 | 3300010167 | Bacteria | 2849 |
| 6 | Ga0466718_022293 | 3300042617 | Bacteria | 4429 |
| 7 | Ga0466726_250270 | 3300042619 | Bacteria | 1636 |
| 8 | AustNasuHG_c1020331 | 3300000089 | Bacteria | 2164 |
| 9 | JGI24702J35022_10086974 | 3300002462 | Bacteria | 1697 |
| 10 | JGI24705J35276_12238798 | 3300002504 | Bacteria | 88644 |
| 11 | Ga0466706_016602 | 3300042599 | Bacteria | 3916 |
| 12 | Ga0466706_067442 | 3300042599 | Bacteria | 1169 |
| 13 | Ga0466706_283806 | 3300042599 | Bacteria | 6774 |
| 14 | Ga0466717_225244 | 3300042604 | Unclassified | 1800 |
| 15 | Ga0466734_163759 | 3300042623 | Bacteria | 2531 |
| 16 | Ga0264413_106570 | 3300024493 | Unclassified | 2843 |
| 17 | Ga0264413_130897 | 3300024493 | Bacteria | 4993 |
| 18 | Ga0415639_121837 | 3300038395 | Unclassified | 1585 |
| 19 | Ga0466690_111897 | 3300042590 | Bacteria | 4292 |
| 20 | Ga0466696_141413 | 3300042596 | Bacteria | 2715 |
| 21 | Ga0123354_10000362 | 3300010882 | Bacteria | 42985 |
| 22 | Ga0466712_243695 | 3300042614 | Unclassified | 6170 |
| 23 | Ga0466723_022975 | 3300042618 | Bacteria | 36124 |
| 24 | JGI24696J40584_12942590 | 3300002834 | Bacteria | 1745 |
| 25 | Ga0072940_1020479 | 3300005200 | Bacteria | 4160 |
| 26 | Ga0466706_237971 | 3300042599 | Unclassified | 4486 |
| 27 | Ga0466707_296253 | 3300042601 | Bacteria | 25031 |
| 28 | Ga0466707_332222 | 3300042601 | Bacteria | 5338 |
| 29 | Ga0466717_064949 | 3300042604 | Bacteria | 1741 |
| 30 | Ga0466719_071996 | 3300042606 | Bacteria | 1963 |
| 31 | Ga0466698_129158 | 3300042610 | Bacteria | 3295 |
| 32 | Ga0466697_217788 | 3300042611 | Bacteria | 1932 |
| 33 | Ga0466690_057826 | 3300042590 | Bacteria | 6106 |
| 34 | Ga0123357_10041087 | 3300009784 | Bacteria | 6289 |
| 35 | Ga0123356_10202454 | 3300010049 | Bacteria | 2026 |
| 36 | Ga0466715_013497 | 3300042616 | Bacteria | 2001 |
| 37 | Ga0466718_143850 | 3300042617 | Bacteria | 2813 |
| 38 | Ga0466726_291070 | 3300042619 | Bacteria | 2436 |
| 39 | JGI24705J35276_12151454 | 3300002504 | Bacteria | 1185 |
| 40 | Ga0068305_10074950 | 3300005083 | Bacteria | 5432 |
| 41 | Ga0123357_10000533 | 3300009784 | Bacteria | 37401 |
| 42 | Ga0466720_012895 | 3300042607 | Bacteria | 75127 |
| 43 | Ga0466731_286073 | 3300042622 | Bacteria | 1739 |
| 44 | Ga0466708_322684 | 3300042652 | Bacteria | 1624 |
| 45 | Ga0466727_048180 | 3300042655 | Bacteria | 6798 |
| 46 | Ga0466727_305826 | 3300042655 | Bacteria | 1693 |
| 47 | Ga0466727_325025 | 3300042655 | Unclassified | 2503 |
| 48 | Ga0466690_084177 | 3300042590 | Bacteria | 1286 |
| 49 | Ga0123353_10008203 | 3300010167 | Bacteria | 14228 |
| 50 | Ga0123353_10121208 | 3300010167 | Unclassified | 4206 |
| 51 | Ga0466726_276913 | 3300042619 | Bacteria | 1202 |
| 52 | Ga0466726_286729 | 3300042619 | Bacteria | 1853 |
| 53 | Ga0466706_280858 | 3300042599 | Bacteria | 94293 |
| 54 | Ga0466720_181890 | 3300042607 | Archaea | 2067 |
| 55 | Ga0466734_046242 | 3300042623 | Bacteria | 2538 |
| 56 | Ga0466735_219683 | 3300042624 | Bacteria | 6117 |
| 57 | Ga0466702_009442 | 3300042635 | Bacteria | 5622 |
| 58 | Ga0466704_038956 | 3300042643 | Bacteria | 5228 |
| 59 | Ga0466709_327724 | 3300042648 | Bacteria | 1687 |
| 60 | Ga0466699_115472 | 3300042597 | Bacteria | 2404 |
| 61 | Ga0123356_10173414 | 3300010049 | Unclassified | 2170 |
| 62 | Ga0466712_002669 | 3300042614 | Bacteria | 2674 |
| 63 | Ga0466712_111221 | 3300042614 | Bacteria | 6733 |
| 64 | Ga0466726_141418 | 3300042619 | Bacteria | 6108 |
| 65 | IMNBL1DRAFT_c0030028 | 3300000062 | Bacteria | 1999 |
| 66 | JGI24695J34938_10001352 | 3300002450 | Bacteria | 21185 |
| 67 | Ga0072941_1004578 | 3300005201 | Bacteria | 4261 |
| 68 | Ga0072941_1042057 | 3300005201 | Bacteria | 8971 |
| 69 | Ga0466714_058436 | 3300042603 | Bacteria | 50482 |
| 70 | Ga0466719_018963 | 3300042606 | Bacteria | 1492 |
| 71 | Ga0466719_281269 | 3300042606 | Bacteria | 12268 |
| 72 | Ga0466721_038780 | 3300042608 | Bacteria | 2150 |
| 73 | Ga0466698_070467 | 3300042610 | Bacteria | 3198 |
| 74 | Ga0466735_073181 | 3300042624 | Bacteria | 3464 |
| 75 | Ga0466704_037070 | 3300042643 | Bacteria | 1274 |
| 76 | Ga0466704_042756 | 3300042643 | Bacteria | 26620 |
| 77 | Ga0466708_042286 | 3300042652 | Bacteria | 6827 |
| 78 | Ga0466705_350702 | 3300042612 | Bacteria | 13104 |
| 79 | Ga0466693_268915 | 3300042592 | Bacteria | 3505 |
| 80 | Ga0123357_10159231 | 3300009784 | Unclassified | 2712 |
| 81 | Ga0123353_10051173 | 3300010167 | Unclassified | 6590 |
| 82 | Ga0466712_163416 | 3300042614 | Bacteria | 22153 |
| 83 | Ga0466711_234409 | 3300042615 | Bacteria | 28488 |
| 84 | Ga0466718_016933 | 3300042617 | Bacteria | 2636 |
| 85 | JGI24695J34938_10001102 | 3300002450 | Bacteria | 24349 |
| 86 | JGI24702J35022_10000399 | 3300002462 | Bacteria | 25810 |
| 87 | JGI24705J35276_12219929 | 3300002504 | Bacteria | 2234 |
| 88 | Ga0466701_098424 | 3300042598 | Bacteria | 1527 |
| 89 | Ga0466706_258089 | 3300042599 | Bacteria | 1338 |
| 90 | Ga0466706_263362 | 3300042599 | Bacteria | 1737 |
| 91 | Ga0466717_257891 | 3300042604 | Bacteria | 1222 |
| 92 | Ga0466703_084607 | 3300042636 | Bacteria | 2894 |
| 93 | Ga0466704_325487 | 3300042643 | Bacteria | 5435 |
| 94 | Ga0466705_131104 | 3300042612 | Bacteria | 34291 |
| 95 | Ga0466657_317659 | 3300042582 | Unclassified | 4491 |
| 96 | Ga0466691_069103 | 3300042593 | Bacteria | 1382 |
| 97 | Ga0123356_10082359 | 3300010049 | Unclassified | 3046 |
| 98 | Ga0123354_10244085 | 3300010882 | Bacteria | 1839 |
| 99 | Ga0123354_10360816 | 3300010882 | Bacteria | 1281 |
| 100 | Ga0466711_052211 | 3300042615 | Bacteria | 7067 |
| 101 | JGI24702J35022_10001408 | 3300002462 | Bacteria | 14985 |
| 102 | Ga0072940_1033133 | 3300005200 | Bacteria | 6080 |
| 103 | Ga0466721_197065 | 3300042608 | Bacteria | 2093 |
| 104 | Ga0466704_178022 | 3300042643 | Bacteria | 1399 |
| 105 | Ga0466709_063853 | 3300042648 | Bacteria | 2563 |
| 106 | Ga0466708_327195 | 3300042652 | Bacteria | 4050 |
| 107 | Ga0466727_182180 | 3300042655 | Unclassified | 1462 |
| 108 | Ga0466727_287727 | 3300042655 | Bacteria | 2140 |
| 109 | Ga0466690_211958 | 3300042590 | Bacteria | 3189 |
| 110 | Ga0123353_10175166 | 3300010167 | Bacteria | 3401 |
| 111 | Ga0466712_048821 | 3300042614 | Bacteria | 17128 |
| 112 | JGI24702J35022_10072707 | 3300002462 | Bacteria | 1854 |
| 113 | Ga0466701_065130 | 3300042598 | Bacteria | 1364 |
| 114 | Ga0466706_163395 | 3300042599 | Bacteria | 14767 |
| 115 | Ga0466706_174016 | 3300042599 | Unclassified | 8080 |
| 116 | Ga0466713_125217 | 3300042602 | Bacteria | 1379 |
| 117 | Ga0466698_487580 | 3300042610 | Bacteria | 1796 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042599 | Ga0466706_016602 | Ga0466706_016602_2227_3114 | 295 |
| 2 | iso_pr_bacteria | 2773857779 | 2774477746 | 295 |
| 3 | 3300002450 | JGI24695J34938_10001102 | JGI24695J34938_100011024 | 296 |
| 4 | 3300042614 | Ga0466712_048821 | Ga0466712_048821_7380_8270 | 296 |
| 5 | 3300042619 | Ga0466726_276913 | Ga0466726_276913_219_1112 | 297 |
| 6 | 3300042599 | Ga0466706_263362 | Ga0466706_263362_516_1433 | 305 |
| 7 | 3300005200 | Ga0072940_1020479 | Ga0072940_10204792 | 306 |
| 8 | 3300042599 | Ga0466706_067442 | Ga0466706_067442_124_1047 | 307 |
| 9 | 3300042550 | Ga0466656_309884 | Ga0466656_309884_23_964 | 313 |
| 10 | 3300042619 | Ga0466726_291070 | Ga0466726_291070_146_1093 | 315 |
| 11 | 3300042652 | Ga0466708_327195 | Ga0466708_327195_2217_3242 | 327 |
| 12 | 3300042655 | Ga0466727_182180 | Ga0466727_182180_25_1071 | 327 |
| 13 | 3300042612 | Ga0466705_350702 | Ga0466705_350702_9089_10087 | 332 |
| 14 | 3300042619 | Ga0466726_286729 | Ga0466726_286729_45_1043 | 332 |
| 15 | iso_pr_bacteria | 2772190894 | 2773439316 | 332 |
| 16 | 3300002462 | JGI24702J35022_10000399 | JGI24702J35022_1000039927 | 333 |
| 17 | 3300042655 | Ga0466727_325025 | Ga0466727_325025_1057_2058 | 333 |
| 18 | 3300042598 | Ga0466701_098424 | Ga0466701_098424_376_1416 | 334 |
| 19 | 3300042599 | Ga0466706_280858 | Ga0466706_280858_41760_42764 | 334 |
| 20 | 3300042598 | Ga0466701_065130 | Ga0466701_065130_85_1134 | 335 |
| 21 | 3300042604 | Ga0466717_257891 | Ga0466717_257891_200_1210 | 336 |
| 22 | 3300042608 | Ga0466721_038780 | Ga0466721_038780_317_1360 | 336 |
| 23 | 3300042610 | Ga0466698_070467 | Ga0466698_070467_1516_2556 | 336 |
| 24 | 3300042610 | Ga0466698_487580 | Ga0466698_487580_612_1652 | 336 |
| 25 | 3300042614 | Ga0466712_111221 | Ga0466712_111221_1232_2242 | 336 |
| 26 | 3300042614 | Ga0466712_163416 | Ga0466712_163416_28_1038 | 336 |
| 27 | 3300042635 | Ga0466702_009442 | Ga0466702_009442_443_1453 | 336 |
| 28 | 3300042636 | Ga0466703_084607 | Ga0466703_084607_528_1538 | 336 |
| 29 | 3300042643 | Ga0466704_325487 | Ga0466704_325487_3223_4233 | 336 |
| 30 | 3300042652 | Ga0466708_322684 | Ga0466708_322684_411_1421 | 336 |
| 31 | iso_pr_bacteria | 2778260941 | 2778358604 | 336 |
| 32 | 3300000089 | AustNasuHG_c1020331 | AustNasuHG_10203313 | 337 |
| 33 | 3300005201 | Ga0072941_1042057 | Ga0072941_10420573 | 337 |
| 34 | 3300042591 | Ga0466692_152545 | Ga0466692_152545_7231_8244 | 337 |
| 35 | 3300042599 | Ga0466706_163395 | Ga0466706_163395_10597_11610 | 337 |
| 36 | 3300042606 | Ga0466719_281269 | Ga0466719_281269_2770_3783 | 337 |
| 37 | 3300042612 | Ga0466705_131104 | Ga0466705_131104_9719_10732 | 337 |
| 38 | 3300042614 | Ga0466712_002669 | Ga0466712_002669_976_1989 | 337 |
| 39 | 3300042615 | Ga0466711_052211 | Ga0466711_052211_132_1145 | 337 |
| 40 | 3300042617 | Ga0466718_022293 | Ga0466718_022293_1871_2884 | 337 |
| 41 | 3300042619 | Ga0466726_141418 | Ga0466726_141418_2703_3767 | 337 |
| 42 | 3300042643 | Ga0466704_178022 | Ga0466704_178022_185_1198 | 337 |
| 43 | 3300042648 | Ga0466709_063853 | Ga0466709_063853_1285_2298 | 337 |
| 44 | iso_pr_bacteria | 2772190893 | 2773437866 | 337 |
| 45 | 3300002504 | JGI24705J35276_12238798 | JGI24705J35276_122387985 | 338 |
| 46 | 3300005201 | Ga0072941_1004578 | Ga0072941_10045784 | 338 |
| 47 | 3300010882 | Ga0123354_10244085 | Ga0123354_102440853 | 338 |
| 48 | 3300042590 | Ga0466690_057826 | Ga0466690_057826_223_1239 | 338 |
| 49 | 3300042590 | Ga0466690_111897 | Ga0466690_111897_1999_3015 | 338 |
| 50 | 3300042624 | Ga0466735_219683 | Ga0466735_219683_1319_2461 | 338 |
| 51 | 3300042652 | Ga0466708_042286 | Ga0466708_042286_5568_6584 | 338 |
| 52 | 3300010167 | Ga0123353_10235615 | Ga0123353_102356152 | 339 |
| 53 | 3300042597 | Ga0466699_115472 | Ga0466699_115472_1366_2385 | 339 |
| 54 | 3300042603 | Ga0466714_058436 | Ga0466714_058436_27460_28479 | 339 |
| 55 | 3300042614 | Ga0466712_243695 | Ga0466712_243695_2801_3820 | 339 |
| 56 | 3300042643 | Ga0466704_038956 | Ga0466704_038956_3524_4543 | 339 |
| 57 | 3300000062 | IMNBL1DRAFT_c0030028 | IMNBL1DRAFT_00300282 | 340 |
| 58 | 3300002504 | JGI24705J35276_12219929 | JGI24705J35276_122199292 | 340 |
| 59 | 3300010882 | Ga0123354_10000362 | Ga0123354_1000036210 | 340 |
| 60 | 3300042615 | Ga0466711_234409 | Ga0466711_234409_350_1372 | 340 |
| 61 | 3300042616 | Ga0466715_013497 | Ga0466715_013497_788_1810 | 340 |
| 62 | iso_pr_bacteria | 2820765201 | 2820765564 | 340 |
| 63 | 3300010167 | Ga0123353_10008203 | Ga0123353_100082032 | 341 |
| 64 | 3300024493 | Ga0264413_106570 | Ga0264413_1065703 | 341 |
| 65 | 3300038395 | Ga0415639_121837 | Ga0415639_121837_205_1230 | 341 |
| 66 | iso_pr_bacteria | 2773857778 | 2774476394 | 341 |
| 67 | 3300002450 | JGI24695J34938_10001352 | JGI24695J34938_1000135214 | 342 |
| 68 | 3300010167 | Ga0123353_10051173 | Ga0123353_100511731 | 342 |
| 69 | 3300042599 | Ga0466706_258089 | Ga0466706_258089_199_1227 | 342 |
| 70 | 3300042606 | Ga0466719_018963 | Ga0466719_018963_300_1328 | 342 |
| 71 | 3300042606 | Ga0466719_071996 | Ga0466719_071996_771_1799 | 342 |
| 72 | 3300042618 | Ga0466723_022975 | Ga0466723_022975_3949_4977 | 342 |
| 73 | 3300042643 | Ga0466704_037070 | Ga0466704_037070_157_1185 | 342 |
| 74 | 3300042590 | Ga0466690_084177 | Ga0466690_084177_81_1112 | 343 |
| 75 | 3300042601 | Ga0466707_296253 | Ga0466707_296253_21151_22182 | 343 |
| 76 | 3300042604 | Ga0466717_064949 | Ga0466717_064949_397_1428 | 343 |
| 77 | 3300042624 | Ga0466735_073181 | Ga0466735_073181_398_1429 | 343 |
| 78 | 3300042648 | Ga0466709_327724 | Ga0466709_327724_448_1479 | 343 |
| 79 | 3300010049 | Ga0123356_10202454 | Ga0123356_102024542 | 344 |
| 80 | 3300042590 | Ga0466690_211958 | Ga0466690_211958_848_1882 | 344 |
| 81 | 3300042623 | Ga0466734_046242 | Ga0466734_046242_277_1341 | 344 |
| 82 | 3300010167 | Ga0123353_10175166 | Ga0123353_101751663 | 345 |
| 83 | 3300042596 | Ga0466696_141413 | Ga0466696_141413_886_1923 | 345 |
| 84 | 3300042611 | Ga0466697_130036 | Ga0466697_130036_268_1305 | 345 |
| 85 | 3300042612 | Ga0466705_070463 | Ga0466705_070463_2506_3543 | 345 |
| 86 | 3300042643 | Ga0466704_042756 | Ga0466704_042756_7103_8140 | 345 |
| 87 | iso_pr_bacteria | 2820776227 | 2820776626 | 345 |
| 88 | 3300009784 | Ga0123357_10000533 | Ga0123357_1000053316 | 346 |
| 89 | 3300010882 | Ga0123354_10360816 | Ga0123354_103608162 | 346 |
| 90 | 3300042582 | Ga0466657_317659 | Ga0466657_317659_1642_2682 | 346 |
| 91 | 3300042599 | Ga0466706_237971 | Ga0466706_237971_158_1198 | 346 |
| 92 | 3300002462 | JGI24702J35022_10086974 | JGI24702J35022_100869741 | 347 |
| 93 | 3300010049 | Ga0123356_10173414 | Ga0123356_101734141 | 347 |
| 94 | 3300042619 | Ga0466726_250270 | Ga0466726_250270_115_1158 | 347 |
| 95 | 3300002462 | JGI24702J35022_10001408 | JGI24702J35022_100014086 | 348 |
| 96 | 3300009784 | Ga0123357_10159231 | Ga0123357_101592311 | 348 |
| 97 | 3300024493 | Ga0264413_130897 | Ga0264413_1308974 | 348 |
| 98 | 3300042607 | Ga0466720_181890 | Ga0466720_181890_125_1171 | 348 |
| 99 | 3300002462 | JGI24702J35022_10072707 | JGI24702J35022_100727072 | 349 |
| 100 | 3300042599 | Ga0466706_174016 | Ga0466706_174016_552_1601 | 349 |
| 101 | 3300042599 | Ga0466706_283806 | Ga0466706_283806_1779_2828 | 349 |
| 102 | 3300042601 | Ga0466707_332222 | Ga0466707_332222_4033_5082 | 349 |
| 103 | 3300042655 | Ga0466727_048180 | Ga0466727_048180_2022_3071 | 349 |
| 104 | 3300042655 | Ga0466727_305826 | Ga0466727_305826_429_1478 | 349 |
| 105 | iso_pr_bacteria | 2820211246 | 2820212240 | 349 |
| 106 | 3300010167 | Ga0123353_10121208 | Ga0123353_101212084 | 350 |
| 107 | 3300042602 | Ga0466713_125217 | Ga0466713_125217_173_1225 | 350 |
| 108 | 3300042610 | Ga0466698_129158 | Ga0466698_129158_2170_3222 | 350 |
| 109 | 3300042617 | Ga0466718_016933 | Ga0466718_016933_960_2012 | 350 |
| 110 | 3300042623 | Ga0466734_163759 | Ga0466734_163759_1180_2232 | 350 |
| 111 | 3300009784 | Ga0123357_10041087 | Ga0123357_100410872 | 351 |
| 112 | 3300042592 | Ga0466693_268915 | Ga0466693_268915_2226_3281 | 351 |
| 113 | 3300042611 | Ga0466697_217788 | Ga0466697_217788_618_1673 | 351 |
| 114 | 3300042604 | Ga0466717_225244 | Ga0466717_225244_523_1581 | 352 |
| 115 | 3300002504 | JGI24705J35276_12151454 | JGI24705J35276_121514541 | 353 |
| 116 | 3300042607 | Ga0466720_012895 | Ga0466720_012895_58679_59746 | 355 |
| 117 | 3300042608 | Ga0466721_197065 | Ga0466721_197065_367_1434 | 355 |
| 118 | 3300042655 | Ga0466727_287727 | Ga0466727_287727_631_1698 | 355 |
| 119 | 3300002834 | JGI24696J40584_12942590 | JGI24696J40584_129425902 | 358 |
| 120 | 3300042622 | Ga0466731_286073 | Ga0466731_286073_44_1120 | 358 |
| 121 | 3300005200 | Ga0072940_1033133 | Ga0072940_10331333 | 359 |
| 122 | 3300010049 | Ga0123356_10082359 | Ga0123356_100823594 | 361 |
| 123 | 3300042593 | Ga0466691_069103 | Ga0466691_069103_181_1284 | 367 |
| 124 | 3300042617 | Ga0466718_143850 | Ga0466718_143850_767_1873 | 368 |
| 125 | 3300005083 | Ga0068305_10074950 | Ga0068305_100749507 | 379 |
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.