Protein Family IF01182
Metagenome
Isolate
112
Members
53
Samples
109
Scaffolds
406.1
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10018912|Ga0068305_100189123
- Length
- 442 aa
- Sequence
- MFDIDRWIEIWATITRNKVRSFLTCLGVFWGILMLVLLLGSGGGLKNGLLGNFEGFATNSVFVFTDRTSEPYKGFNKGRYWNMRNRDIESIRNNVPEADIVSGFLSGSRSEKNVVYGQLTGTYYVEGAFPEQFRILIPTLIYGRLLNEIDIAEKRKVCVIGSDINKTLFRNENSCGKYIRVNGIYYQIVGVVAPKTSNVNINGRTEEKVVLPFTTMQQSLNQGDIVHSLCITGRKGHTIRAMIDGVTAVLKSQNEISPTDPQAVRVINIAEQFETFGKLFTGIDILVWLVGMGTLLAGIIGISNIMMVTVKERTKEIGVRRALGAKPFNIISQVMSESLVLTALAGLLGLSLGVFILDMVDKILTAQQAAASGNTFFEHPSVSIQTAAAATVVLLISGLAAGLIPAWRAMQAHHLIGIGGNSGTQYVLLPVEESAAGDNRL*
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Kalotermitidae
24.5%
Unclassified
9.4%
Termopsidae
7.5%
Rhinotermitidae
5.7%
Formicidae
5.7%
Passalidae
5.7%
Blattidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 15 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 16 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 23 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0000778 | 3300000062 | Bacteria | 25187 |
| 2 | Ga0068302_10053968 | 3300005071 | Bacteria | 9357 |
| 3 | Ga0466735_125231 | 3300042624 | Bacteria | 6413 |
| 4 | Ga0466735_229760 | 3300042624 | Bacteria | 2518 |
| 5 | Ga0466704_040778 | 3300042643 | Bacteria | 10718 |
| 6 | Ga0466723_146714 | 3300042618 | Bacteria | 10011 |
| 7 | Ga0466726_027894 | 3300042619 | Bacteria | 10594 |
| 8 | Ga0123357_10192844 | 3300009784 | Bacteria | 2342 |
| 9 | Ga0123353_10229005 | 3300010167 | Bacteria | 2900 |
| 10 | Ga0466716_128873 | 3300042605 | Bacteria | 20808 |
| 11 | Ga0466719_175438 | 3300042606 | Bacteria | 4108 |
| 12 | Ga0466719_527260 | 3300042606 | Bacteria | 1910 |
| 13 | Ga0466697_193799 | 3300042611 | Bacteria | 2854 |
| 14 | JGI24702J35022_10000672 | 3300002462 | Bacteria | 20792 |
| 15 | Ga0068305_10122819 | 3300005083 | Unclassified | 5206 |
| 16 | Ga0102735_1000287 | 3300007080 | Bacteria | 11856 |
| 17 | Ga0466727_325984 | 3300042655 | Bacteria | 1465 |
| 18 | Ga0466710_347193 | 3300042613 | Bacteria | 2004 |
| 19 | Ga0466715_100521 | 3300042616 | Unclassified | 6564 |
| 20 | Ga0466723_116763 | 3300042618 | Bacteria | 15819 |
| 21 | Ga0123356_10139330 | 3300010049 | Bacteria | 2391 |
| 22 | Ga0123354_10000656 | 3300010882 | Bacteria | 36511 |
| 23 | Ga0466656_347727 | 3300042550 | Bacteria | 1607 |
| 24 | Ga0466690_095011 | 3300042590 | Bacteria | 9755 |
| 25 | Ga0466692_022740 | 3300042591 | Bacteria | 15073 |
| 26 | Ga0466719_035543 | 3300042606 | Bacteria | 10370 |
| 27 | Ga0466732_056943 | 3300042656 | Bacteria | 10693 |
| 28 | Ga0466732_250889 | 3300042656 | Bacteria | 1734 |
| 29 | 2227521581 | 2225789004 | Bacteria | 3330 |
| 30 | Ga0466704_382218 | 3300042643 | Bacteria | 2361 |
| 31 | Ga0466711_094074 | 3300042615 | Bacteria | 13061 |
| 32 | Ga0466711_149988 | 3300042615 | Bacteria | 5322 |
| 33 | Ga0466711_204610 | 3300042615 | Bacteria | 10109 |
| 34 | Ga0466718_099392 | 3300042617 | Bacteria | 1496 |
| 35 | Ga0123353_10002312 | 3300010167 | Bacteria | 23671 |
| 36 | Ga0466690_236448 | 3300042590 | Bacteria | 4896 |
| 37 | Ga0466713_081971 | 3300042602 | Bacteria | 2379 |
| 38 | Ga0466714_060946 | 3300042603 | Bacteria | 3371 |
| 39 | Ga0466714_102935 | 3300042603 | Bacteria | 3219 |
| 40 | Ga0466733_216481 | 3300042659 | Bacteria | 14138 |
| 41 | Ga0068305_10018912 | 3300005083 | Bacteria | 5676 |
| 42 | Ga0466734_122869 | 3300042623 | Bacteria | 1605 |
| 43 | Ga0466730_090432 | 3300042625 | Bacteria | 7143 |
| 44 | Ga0466704_461185 | 3300042643 | Bacteria | 28981 |
| 45 | Ga0466708_024546 | 3300042652 | Bacteria | 37398 |
| 46 | Ga0466708_098063 | 3300042652 | Bacteria | 8204 |
| 47 | Ga0466727_102556 | 3300042655 | Bacteria | 5299 |
| 48 | Ga0466715_109794 | 3300042616 | Bacteria | 37807 |
| 49 | Ga0466723_046709 | 3300042618 | Bacteria | 21444 |
| 50 | Ga0466729_114703 | 3300042621 | Bacteria | 8889 |
| 51 | Ga0123354_10001134 | 3300010882 | Bacteria | 31081 |
| 52 | Ga0466691_040271 | 3300042593 | Bacteria | 19293 |
| 53 | Ga0466695_235673 | 3300042595 | Bacteria | 18098 |
| 54 | Ga0466696_489056 | 3300042596 | Bacteria | 3534 |
| 55 | Ga0466707_018939 | 3300042601 | Bacteria | 18217 |
| 56 | Ga0466707_218377 | 3300042601 | Bacteria | 11249 |
| 57 | Ga0466707_233004 | 3300042601 | Bacteria | 2896 |
| 58 | Ga0466713_009199 | 3300042602 | Bacteria | 8653 |
| 59 | 2227111371 | 2225789004 | Bacteria | 9422 |
| 60 | 2227303000 | 2225789004 | Bacteria | 29649 |
| 61 | IMNBL1DRAFT_c0003993 | 3300000062 | Bacteria | 9090 |
| 62 | CVPL010W_10001643 | 3300002931 | Bacteria | 26841 |
| 63 | Ga0102734_1000180 | 3300007129 | Bacteria | 20172 |
| 64 | Ga0466704_402295 | 3300042643 | Bacteria | 7618 |
| 65 | Ga0466711_261641 | 3300042615 | Bacteria | 27442 |
| 66 | Ga0466715_024418 | 3300042616 | Bacteria | 13353 |
| 67 | Ga0466726_352291 | 3300042619 | Bacteria | 2527 |
| 68 | Ga0466706_006892 | 3300042599 | Bacteria | 6984 |
| 69 | Ga0466700_159036 | 3300042600 | Bacteria | 10259 |
| 70 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 71 | Ga0466716_092661 | 3300042605 | Bacteria | 34549 |
| 72 | Ga0466722_151805 | 3300042609 | Bacteria | 2309 |
| 73 | Ga0466698_267600 | 3300042610 | Bacteria | 4455 |
| 74 | 2227008134 | 2225789003 | Bacteria | 27277 |
| 75 | 2227197484 | 2225789004 | Bacteria | 7797 |
| 76 | IMNBL1DRAFT_c0002743 | 3300000062 | Bacteria | 11983 |
| 77 | IMNBL1DRAFT_c0003150 | 3300000062 | Bacteria | 10845 |
| 78 | JGI24705J35276_12228521 | 3300002504 | Bacteria | 3201 |
| 79 | Ga0068302_10070490 | 3300005071 | Bacteria | 5993 |
| 80 | Ga0466715_161567 | 3300042616 | Bacteria | 22971 |
| 81 | Ga0466707_049391 | 3300042601 | Bacteria | 4924 |
| 82 | Ga0466707_212369 | 3300042601 | Bacteria | 1297 |
| 83 | Ga0466713_023619 | 3300042602 | Bacteria | 28576 |
| 84 | Ga0466698_299199 | 3300042610 | Unclassified | 3137 |
| 85 | Ga0466697_281283 | 3300042611 | Bacteria | 1372 |
| 86 | Ga0466705_221960 | 3300042612 | Bacteria | 7432 |
| 87 | Ga0466704_352277 | 3300042643 | Bacteria | 13970 |
| 88 | Ga0466727_297477 | 3300042655 | Bacteria | 7302 |
| 89 | Ga0123356_10030655 | 3300010049 | Bacteria | 5033 |
| 90 | Ga0466657_121324 | 3300042582 | Bacteria | 2340 |
| 91 | Ga0466692_179176 | 3300042591 | Bacteria | 7920 |
| 92 | Ga0466717_096457 | 3300042604 | Bacteria | 1447 |
| 93 | Ga0466716_527992 | 3300042605 | Bacteria | 9605 |
| 94 | Ga0466722_137495 | 3300042609 | Bacteria | 11651 |
| 95 | 2227247463 | 2225789004 | Bacteria | 31431 |
| 96 | IMNBL1DRAFT_c0001430 | 3300000062 | Bacteria | 17865 |
| 97 | Ga0466729_207095 | 3300042621 | Bacteria | 1874 |
| 98 | Ga0466703_012244 | 3300042636 | Bacteria | 10258 |
| 99 | Ga0466723_010238 | 3300042618 | Bacteria | 11206 |
| 100 | Ga0466726_061036 | 3300042619 | Bacteria | 14397 |
| 101 | Ga0466728_034392 | 3300042620 | Bacteria | 3371 |
| 102 | Ga0123354_10007896 | 3300010882 | Bacteria | 16123 |
| 103 | Ga0466656_209194 | 3300042550 | Bacteria | 12543 |
| 104 | Ga0466690_108802 | 3300042590 | Bacteria | 9746 |
| 105 | Ga0466691_167761 | 3300042593 | Bacteria | 11914 |
| 106 | Ga0466700_184482 | 3300042600 | Bacteria | 7877 |
| 107 | Ga0466707_100729 | 3300042601 | Bacteria | 10660 |
| 108 | Ga0466714_091992 | 3300042603 | Bacteria | 3238 |
| 109 | Ga0466697_001263 | 3300042611 | Bacteria | 1405 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.